| UniProt ID | RS10_RAT | |
|---|---|---|
| UniProt AC | P63326 | |
| Protein Name | 40S ribosomal protein S10 | |
| Gene Name | Rps10 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 165 | |
| Subcellular Localization | Cytoplasm. Nucleus, nucleolus. Localized in the granular component (GC) region of the nucleolus. Methylation is required for its localization in the GC region. Colocalizes with NPS1 in the GC region of the nucleolus (By similarity).. | |
| Protein Description | Component of the 40S ribosomal subunit.. | |
| Protein Sequence | MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGPEGERPARFTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQPPQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 12 | Phosphorylation | KKNRIAIYELLFKEG CCCCCHHHHHHHHCC | 7.48 | 28432305 | |
| 25 | Succinylation | EGVMVAKKDVHMPKH CCCEEEECCCCCCCC | 56.07 | 26843850 | |
| 82 | Phosphorylation | GIQYLRDYLHLPPEI HHHHHHHHHCCCHHH | 6.92 | 30181290 | |
| 93 | Phosphorylation | PPEIVPATLRRSRPE CHHHHCHHHHCCCCC | 18.09 | 23984901 | |
| 107 | Ubiquitination | ETGRPRPKGPEGERP CCCCCCCCCCCCCCC | 84.27 | - | |
| 119 | Methylation | ERPARFTRGEADRDT CCCCCCCCCCCCHHH | 37.94 | 12018795 | |
| 126 | Phosphorylation | RGEADRDTYRRSAVP CCCCCHHHHHHHCCC | 21.59 | 25403869 | |
| 138 | Ubiquitination | AVPPGADKKAEAGAG CCCCCCCCCCCCCCC | 54.04 | - | |
| 139 | Ubiquitination | VPPGADKKAEAGAGS CCCCCCCCCCCCCCC | 52.59 | - | |
| 146 | Phosphorylation | KAEAGAGSATEFQFR CCCCCCCCCCEEEEC | 31.33 | 27097102 | |
| 148 | Phosphorylation | EAGAGSATEFQFRGG CCCCCCCCEEEECCC | 38.74 | 25403869 | |
| 153 | Methylation | SATEFQFRGGFGRGR CCCEEEECCCCCCCC | 33.28 | - | |
| 158 | Symmetric dimethylarginine | QFRGGFGRGRGQPPQ EECCCCCCCCCCCCC | 29.40 | - | |
| 158 | Methylation | QFRGGFGRGRGQPPQ EECCCCCCCCCCCCC | 29.40 | - | |
| 160 | Symmetric dimethylarginine | RGGFGRGRGQPPQ-- CCCCCCCCCCCCC-- | 38.93 | - | |
| 160 | Methylation | RGGFGRGRGQPPQ-- CCCCCCCCCCCCC-- | 38.93 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS10_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS10_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS10_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RS10_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
