RS10B_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS10B_SCHPO
• UniProt AC: O13614
• Protein Name: 40S ribosomal protein S10-B
• Gene Name: rps1002
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 147
• Protein Sequence: MLIPKENRKAIHQALFQQGVLVAKKDFNLPKHPEVGVPNLQVIKACQSLDSRGYLKTRYNWGWFYYTLTNEGVEYLREYLHLPAEVVPATHKRQVRPAAPRAGRPEPRERSSAADAGYRRAEKKDDGAAPGGFAPSFRGGFGRPVAA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
48	Phosphorylation	QVIKACQSLDSRGYL HHHHHHHHCCCCCCE	33.75	27738172
111	Phosphorylation	RPEPRERSSAADAGY CCCCCHHCHHHHHHH	21.41	29996109
112	Phosphorylation	PEPRERSSAADAGYR CCCCHHCHHHHHHHH	33.43	25720772
136	Phosphorylation	APGGFAPSFRGGFGR CCCCCCCCCCCCCCC	24.93	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS10B_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS10B_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS10B_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of RS10B_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.