dbPTM

RRP8_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RRP8_MOUSE
UniProt AC	Q9DB85
Protein Name	Ribosomal RNA-processing protein 8
Gene Name	Rrp8
Organism	Mus musculus (Mouse).
Sequence Length	457
Subcellular Localization	Nucleus, nucleolus. Localizes at rDNA locus..
Protein Description	Essential component of the eNoSC (energy-dependent nucleolar silencing) complex, a complex that mediates silencing of rDNA in response to intracellular energy status and acts by recruiting histone-modifying enzymes. The eNoSC complex is able to sense the energy status of cell: upon glucose starvation, elevation of NAD(+)/NADP(+) ratio activates SIRT1, leading to histone H3 deacetylation followed by dimethylation of H3 at 'Lys-9' (H3K9me2) by SUV39H1 and the formation of silent chromatin in the rDNA locus. In the complex, RRP8 binds to H3K9me2 and probably acts as a methyltransferase. Its substrates are however unknown (By similarity)..
Protein Sequence	MFEEPEWVEAAPAIVGLGAATAQVRPATAPPVKGRKRRHLLATLRALEAASLSQQTPSLPGSDSEEEEEVGRKKRHLQRPSLASVSKEVGKKRKGKCQKQAPSISDSEGKEIRRKCHRQAPPLGGVSAGEEKGKRKCQEYSSLHLTQPLDSVDQTVHNSRTSTATIDPSKPSPESMSPNSSHTLSRKQWRNRQKNKRRHKNKFRPLQTPEQAPPKASIEETEVPPVPKSDSQESRAGALRARMTQRLDGARFRYLNEQLYSGPSSAARRLFQEDPEAFLLYHRGFQRQVKKWPLHPVDRIAKDLRQKPASLVVADFGCGDCRLASSVRNPVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKTGGLLKVAEVSSRFEDIRTFLGAVTKLGFKIIYKDLTNSHFFLFDFEKTGPPRVGPKAQLSGLKLQPCLYKRR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
51	Phosphorylation	LRALEAASLSQQTPS HHHHHHHHHHHCCCC	35.28	25619855
53	Phosphorylation	ALEAASLSQQTPSLP HHHHHHHHHCCCCCC	20.11	25619855
56	Phosphorylation	AASLSQQTPSLPGSD HHHHHHCCCCCCCCC	13.75	25619855
58	Phosphorylation	SLSQQTPSLPGSDSE HHHHCCCCCCCCCCH	51.05	27087446
62	Phosphorylation	QTPSLPGSDSEEEEE CCCCCCCCCCHHHHH	35.70	27087446
64	Phosphorylation	PSLPGSDSEEEEEVG CCCCCCCCHHHHHHH	48.91	27087446
84	Phosphorylation	LQRPSLASVSKEVGK HCCCCHHHHHHHHHH	32.01	28066266
86	Phosphorylation	RPSLASVSKEVGKKR CCCHHHHHHHHHHHC	22.17	28066266
103	Phosphorylation	KCQKQAPSISDSEGK CCCCCCCCCCHHHHH	37.43	25159016
105	Phosphorylation	QKQAPSISDSEGKEI CCCCCCCCHHHHHHH	39.15	25521595
107	Phosphorylation	QAPSISDSEGKEIRR CCCCCCHHHHHHHHH	41.27	25159016
161	Phosphorylation	QTVHNSRTSTATIDP HHHHCCCCCCEECCC	30.19	25619855
162	Phosphorylation	TVHNSRTSTATIDPS HHHCCCCCCEECCCC	18.22	25619855
163	Phosphorylation	VHNSRTSTATIDPSK HHCCCCCCEECCCCC	27.49	25619855
165	Phosphorylation	NSRTSTATIDPSKPS CCCCCCEECCCCCCC	26.46	25619855
169	Phosphorylation	STATIDPSKPSPESM CCEECCCCCCCCCCC	54.15	25619855
172	Phosphorylation	TIDPSKPSPESMSPN ECCCCCCCCCCCCCC	45.06	22942356
175	Phosphorylation	PSKPSPESMSPNSSH CCCCCCCCCCCCCCC	28.13	22942356
177	Phosphorylation	KPSPESMSPNSSHTL CCCCCCCCCCCCCCC	30.15	26824392
180	Phosphorylation	PESMSPNSSHTLSRK CCCCCCCCCCCCCHH	27.21	22942356
181	Phosphorylation	ESMSPNSSHTLSRKQ CCCCCCCCCCCCHHH	27.42	25619855
183	Phosphorylation	MSPNSSHTLSRKQWR CCCCCCCCCCHHHHH	28.51	25619855
185	Phosphorylation	PNSSHTLSRKQWRNR CCCCCCCCHHHHHHH	38.29	25619855
208	Phosphorylation	NKFRPLQTPEQAPPK CCCCCCCCCCCCCCC	36.15	26745281
234	Phosphorylation	PKSDSQESRAGALRA CCCCCHHHHHHHHHH	21.57	20139300
448	Acetylation	KAQLSGLKLQPCLYK CHHHCCCCCCCCCCC	48.91	22826441

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RRP8_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RRP8_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RRP8_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RRP8_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RRP8_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-58; SER-62 AND SER-64,AND MASS SPECTROMETRY.	17242355 [Abstract]