UniProt ID | RRP8_DROME | |
---|---|---|
UniProt AC | Q7K2B0 | |
Protein Name | Ribosomal RNA-processing protein 8 | |
Gene Name | CG7137 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 358 | |
Subcellular Localization | Nucleus, nucleolus. | |
Protein Description | Probable methyltransferase required to silence rDNA.. | |
Protein Sequence | MKPFEVPPWEEGADIIEFEPVNPSGNGVAAKKKPKKKKPKKKKAAVPNENLNVNKAAEKFTYRQGRGPLAPPQDSSDDDYEDVEDGIRAMHKVKSGRIEKQRPPTQATKGGKKELKLKPELAQAALEAMEATSSTTPAANSLASKLQSELLGGRFRYINEQLYSTTSRKAEALFRKDSSAFEAYHAGYRQQVEKWPINPLNRIIKTIKKIPKTAIIGDFGCGEGKLAQSVPNKVYSMDLVAARSDIIACNITDTPLQARTLDVAVYCLSLMGTDLNEFFLEANRVLKLHGTVYIAEIQSRFQDVREFVRCLNACGFDLNKKDVAVNYFYFFQFKKMRHVPKNTKMKAFSLKPCLYRKR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
75 | Phosphorylation | PLAPPQDSSDDDYED CCCCCCCCCCCCHHH | 30.35 | 19429919 | |
76 | Phosphorylation | LAPPQDSSDDDYEDV CCCCCCCCCCCHHHH | 54.04 | 19429919 | |
80 | Phosphorylation | QDSSDDDYEDVEDGI CCCCCCCHHHHHHHH | 22.48 | 19429919 | |
273 | Phosphorylation | YCLSLMGTDLNEFFL HHHHHHCCCHHHHHH | 24.29 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RRP8_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RRP8_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RRP8_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RRP8_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-75 AND SER-76, AND MASSSPECTROMETRY. |