dbPTM

RRP8_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RRP8_DROME
UniProt AC	Q7K2B0
Protein Name	Ribosomal RNA-processing protein 8
Gene Name	CG7137
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	358
Subcellular Localization	Nucleus, nucleolus.
Protein Description	Probable methyltransferase required to silence rDNA..
Protein Sequence	MKPFEVPPWEEGADIIEFEPVNPSGNGVAAKKKPKKKKPKKKKAAVPNENLNVNKAAEKFTYRQGRGPLAPPQDSSDDDYEDVEDGIRAMHKVKSGRIEKQRPPTQATKGGKKELKLKPELAQAALEAMEATSSTTPAANSLASKLQSELLGGRFRYINEQLYSTTSRKAEALFRKDSSAFEAYHAGYRQQVEKWPINPLNRIIKTIKKIPKTAIIGDFGCGEGKLAQSVPNKVYSMDLVAARSDIIACNITDTPLQARTLDVAVYCLSLMGTDLNEFFLEANRVLKLHGTVYIAEIQSRFQDVREFVRCLNACGFDLNKKDVAVNYFYFFQFKKMRHVPKNTKMKAFSLKPCLYRKR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
75	Phosphorylation	PLAPPQDSSDDDYED CCCCCCCCCCCCHHH	30.35	19429919
76	Phosphorylation	LAPPQDSSDDDYEDV CCCCCCCCCCCHHHH	54.04	19429919
80	Phosphorylation	QDSSDDDYEDVEDGI CCCCCCCHHHHHHHH	22.48	19429919
273	Phosphorylation	YCLSLMGTDLNEFFL HHHHHHCCCHHHHHH	24.29	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RRP8_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RRP8_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RRP8_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RRP8_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RRP8_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-75 AND SER-76, AND MASSSPECTROMETRY.	18327897 [Abstract]