UniProt ID | RRP7A_MOUSE | |
---|---|---|
UniProt AC | Q9D1C9 | |
Protein Name | Ribosomal RNA-processing protein 7 homolog A | |
Gene Name | Rrp7a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 280 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVSRRKKRKAGGHEESIPSPPGYSAVPVKFSAKQQAPHYLYMRQHRVRQGTQSTWPPDRTLFILNVPPYCTQESLSRCLSCCGTIKTVELQEKPDLAESPTEPKSQFFHPKPVPGFQVAYVVFQKPSGVSAALNLKGPLLVSTESHLVKSGIHKWISDYEDSVLDPEALRMEVDAFMEAYDKKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLEKEKRKRARKELLNFYAWQHRETKMEHLAQLRKKFEEDKQRIELMRAQRKFRPY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | KAGGHEESIPSPPGY CCCCCCCCCCCCCCC | 36.49 | 28059163 | |
19 | Phosphorylation | GHEESIPSPPGYSAV CCCCCCCCCCCCCCC | 41.90 | 26026062 | |
24 | Phosphorylation | IPSPPGYSAVPVKFS CCCCCCCCCCCCEEC | 28.80 | 26026062 | |
99 | Phosphorylation | EKPDLAESPTEPKSQ CCCCCCCCCCCCHHH | 31.36 | 22942356 | |
101 | Phosphorylation | PDLAESPTEPKSQFF CCCCCCCCCCHHHCC | 74.36 | 25619855 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RRP7A_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RRP7A_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RRP7A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RRP7A_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...