RRP7A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RRP7A_MOUSE
• UniProt AC: Q9D1C9
• Protein Name: Ribosomal RNA-processing protein 7 homolog A
• Gene Name: Rrp7a
• Organism: Mus musculus (Mouse).
• Sequence Length: 280
• Protein Sequence: MVSRRKKRKAGGHEESIPSPPGYSAVPVKFSAKQQAPHYLYMRQHRVRQGTQSTWPPDRTLFILNVPPYCTQESLSRCLSCCGTIKTVELQEKPDLAESPTEPKSQFFHPKPVPGFQVAYVVFQKPSGVSAALNLKGPLLVSTESHLVKSGIHKWISDYEDSVLDPEALRMEVDAFMEAYDKKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLEKEKRKRARKELLNFYAWQHRETKMEHLAQLRKKFEEDKQRIELMRAQRKFRPY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	KAGGHEESIPSPPGY CCCCCCCCCCCCCCC	36.49	28059163
19	Phosphorylation	GHEESIPSPPGYSAV CCCCCCCCCCCCCCC	41.90	26026062
24	Phosphorylation	IPSPPGYSAVPVKFS CCCCCCCCCCCCEEC	28.80	26026062
99	Phosphorylation	EKPDLAESPTEPKSQ CCCCCCCCCCCCHHH	31.36	22942356
101	Phosphorylation	PDLAESPTEPKSQFF CCCCCCCCCCHHHCC	74.36	25619855

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RRP7A_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RRP7A_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RRP7A_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RRP7A_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.