RRP4_SCHPO - dbPTM
RRP4_SCHPO - PTM Information in dbPTM
Basic Information of Protein
UniProt ID RRP4_SCHPO
UniProt AC Q09704
Protein Name Exosome complex component rrp4
Gene Name rrp4
Organism Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length 329
Subcellular Localization Cytoplasm . Nucleus .
Protein Description Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and cryptic unstable transcripts (CUTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and in RNA surveillance pathways, preventing translation of aberrant mRNAs. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. rrp4 as peripheral part of the Exo-9 complex is thought to stabilize the hexameric ring of RNase PH-domain subunits (By similarity)..
Protein Sequence MVTILKPEEFYVSSEADIVNDVSMTEMEDEIMEDEQMGLVDGEDVLEEFDKSIHQNLVTPGQLVTDDPQFMRGHGTYFEDGGIYASVAGSVQRVNKLISVKPLRSKYVPEIGDLIIGKIAEVQPKRWKVDIGAKQNAVLMLSSINLPGGIQRRKLETDELQMRSFFQEGDLLVAEVQQYFSDGSVSIHTRSLKYGKLRNGVFLKVPPALVVRSKSHAYALAGGVDIILSVNGYVWVSKHNENQHSSVSITRLEEEASESIYSNENDEIDGYTRLNISRVSICIKGLASRSLPLTQASITNFYESSLVFSNLQDLTVPKNMDQIAMEAMQ
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of RRP4_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of RRP4_SCHPO !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of RRP4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of RRP4_SCHPO !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
SFC4_SCHPOsfc4physical
26771498

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of RRP4_SCHPO

loading...

Related Literatures of Post-Translational Modification

TOP