dbPTM

RRN9_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RRN9_SCHPO
UniProt AC	Q10204
Protein Name	RNA polymerase I-specific transcription initiation factor RRN9 homolog
Gene Name	acr1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	250
Subcellular Localization	Nucleus, nucleolus .
Protein Description	Component of the UAF (upstream activation factor) complex which interacts with the upstream element of the RNA polymerase I promoter and is required for the proper accumulation of rpa1/nuc1 at rDNAs. Required for nucleolar localization of condensin..
Protein Sequence	MNDSEEELEQQGSQEDISSSQDTSDEKEMRKQDALYAQLIEYREIVSELRRSEMKNLCIQLYCSYKAGITRRNELQSDLDGYERRIPPRLRAVWPTIHSIPDESFFDGTSASRFRQEAAYLAVRLASKKLHKLGRMASSEELPNPDGLRYLVERLQIKLERLFDSVDTFRQEQGSKSMQSRVKPMDWKILYGLARVTNGSFSSSQKADVLALGNGTRACQSLFKEMSLQPSIDIEKVSHSNPEISIEFED

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RRN9_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RRN9_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RRN9_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RRN9_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RRN9_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RRN9_SCHPO

Related Literatures of Post-Translational Modification