UniProt ID | RR17_ARATH | |
---|---|---|
UniProt AC | P16180 | |
Protein Name | 30S ribosomal protein S17, chloroplastic | |
Gene Name | RPS17 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 149 | |
Subcellular Localization | Plastid, chloroplast . | |
Protein Description | One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA (By similarity). Required for optimal plastid performance in terms of photosynthesis and growth. Required for the translation of plastid mRNAs. Plays a critical role in biosynthesis of thylakoid membrane proteins encoded by chloroplast genes. [PubMed: 22900828] | |
Protein Sequence | MITSSLTSSLQALKLSSPFAHGSTPLSSLSKPNSFPNHRMPALVPVIRAMKTMQGRVVCATSDKTVAVEVVRLAPHPKYKRRVRMKKKYQAHDPDNQFKVGDVVRLEKSRPISKTKSFVALPVIARAARKAEAGGDELLGLPLESQQPA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MITSSLTSSL -----CCCHHHHHHH | 15.80 | 19880383 | |
4 | Phosphorylation | ----MITSSLTSSLQ ----CCCHHHHHHHH | 16.66 | 19880383 | |
5 | Phosphorylation | ---MITSSLTSSLQA ---CCCHHHHHHHHH | 27.32 | 19880383 | |
115 | Phosphorylation | KSRPISKTKSFVALP CCCCCCCCCCCHHHH | 25.73 | 19376835 | |
117 | Phosphorylation | RPISKTKSFVALPVI CCCCCCCCCHHHHHH | 30.13 | 30291188 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RR17_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RR17_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RR17_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RR17_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...