dbPTM

RR17_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RR17_ARATH
UniProt AC	P16180
Protein Name	30S ribosomal protein S17, chloroplastic
Gene Name	RPS17
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	149
Subcellular Localization	Plastid, chloroplast .
Protein Description	One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA (By similarity). Required for optimal plastid performance in terms of photosynthesis and growth. Required for the translation of plastid mRNAs. Plays a critical role in biosynthesis of thylakoid membrane proteins encoded by chloroplast genes. [PubMed: 22900828]
Protein Sequence	MITSSLTSSLQALKLSSPFAHGSTPLSSLSKPNSFPNHRMPALVPVIRAMKTMQGRVVCATSDKTVAVEVVRLAPHPKYKRRVRMKKKYQAHDPDNQFKVGDVVRLEKSRPISKTKSFVALPVIARAARKAEAGGDELLGLPLESQQPA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MITSSLTSSL -----CCCHHHHHHH	15.80	19880383
4	Phosphorylation	----MITSSLTSSLQ ----CCCHHHHHHHH	16.66	19880383
5	Phosphorylation	---MITSSLTSSLQA ---CCCHHHHHHHHH	27.32	19880383
115	Phosphorylation	KSRPISKTKSFVALP CCCCCCCCCCCHHHH	25.73	19376835
117	Phosphorylation	RPISKTKSFVALPVI CCCCCCCCCHHHHHH	30.13	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RR17_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RR17_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RR17_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RR17_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RR17_ARATH

Related Literatures of Post-Translational Modification