dbPTM

RR14_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RR14_ARATH
UniProt AC	P56804
Protein Name	30S ribosomal protein S14, chloroplastic {ECO:0000255\|HAMAP-Rule:MF_00537}
Gene Name	rps14 {ECO:0000255\|HAMAP-Rule:MF_00537}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	100
Subcellular Localization	Plastid, chloroplast.
Protein Description	Binds 16S rRNA, required for the assembly of 30S particles..
Protein Sequence	MAKKSLIYREKKRQKLEKKYHLIRRSLKKEISKIPSLSEKWKIHGKLQSLPRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVQACLLPGATRSSW

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
49	Phosphorylation	KIHGKLQSLPRNSAP CCCHHHHCCCCCCCC	51.26	21768351

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RR14_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RR14_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RR14_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RR14_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RR14_ARATH

Related Literatures of Post-Translational Modification