dbPTM

RR14N_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RR14N_SCHPO
UniProt AC	O14279
Protein Name	Ribosomal RNA-processing protein 14-N
Gene Name	rrp14n
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	154
Subcellular Localization	Nucleus, nucleolus .
Protein Description	Involved in ribosome biogenesis and cell polarity. Required for the synthesis of both 40S and 60S ribosomal subunits and may also play some direct role in correct positioning of the mitotic spindle during mitosis (By similarity)..
Protein Sequence	MTEVEERINAWNDGFEELLSYIPAKLYYREHTANQWKQKKSTLEEKKERRKMKFSLDGLVNDADDDSQKSSKWEQSSTMSDDTDVSDRHAESMSQIRGKLASKIQDLREKRKAGDLNQKRQNKRPVENEKDSQKGSGKSKVQKKKHKASPRAGF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
55	Phosphorylation	ERRKMKFSLDGLVND HHHHHHHCHHHCCCC	21.74	24763107
67	Phosphorylation	VNDADDDSQKSSKWE CCCCCCCCHHCCHHH	46.64	21712547
78	Phosphorylation	SKWEQSSTMSDDTDV CHHHHHCCCCCCCCH	26.41	21712547
80	Phosphorylation	WEQSSTMSDDTDVSD HHHHCCCCCCCCHHH	32.21	28889911
83	Phosphorylation	SSTMSDDTDVSDRHA HCCCCCCCCHHHHHH	43.20	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RR14N_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RR14N_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RR14N_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RR14N_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RR14N_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-80 AND THR-83, AND MASSSPECTROMETRY.	18257517 [Abstract]