| UniProt ID | RR14N_SCHPO | |
|---|---|---|
| UniProt AC | O14279 | |
| Protein Name | Ribosomal RNA-processing protein 14-N | |
| Gene Name | rrp14n | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 154 | |
| Subcellular Localization | Nucleus, nucleolus . | |
| Protein Description | Involved in ribosome biogenesis and cell polarity. Required for the synthesis of both 40S and 60S ribosomal subunits and may also play some direct role in correct positioning of the mitotic spindle during mitosis (By similarity).. | |
| Protein Sequence | MTEVEERINAWNDGFEELLSYIPAKLYYREHTANQWKQKKSTLEEKKERRKMKFSLDGLVNDADDDSQKSSKWEQSSTMSDDTDVSDRHAESMSQIRGKLASKIQDLREKRKAGDLNQKRQNKRPVENEKDSQKGSGKSKVQKKKHKASPRAGF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 55 | Phosphorylation | ERRKMKFSLDGLVND HHHHHHHCHHHCCCC | 21.74 | 24763107 | |
| 67 | Phosphorylation | VNDADDDSQKSSKWE CCCCCCCCHHCCHHH | 46.64 | 21712547 | |
| 78 | Phosphorylation | SKWEQSSTMSDDTDV CHHHHHCCCCCCCCH | 26.41 | 21712547 | |
| 80 | Phosphorylation | WEQSSTMSDDTDVSD HHHHCCCCCCCCHHH | 32.21 | 28889911 | |
| 83 | Phosphorylation | SSTMSDDTDVSDRHA HCCCCCCCCHHHHHH | 43.20 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RR14N_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RR14N_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RR14N_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RR14N_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...