RR13_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RR13_ARATH
• UniProt AC: P42732
• Protein Name: 30S ribosomal protein S13, chloroplastic
• Gene Name: RPS13
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 169
• Subcellular Localization: Plastid, chloroplast.
• Protein Description: Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA..
• Protein Sequence: MAQMVAMPVAHSLSLICNWAKSNPLSRNTLALPASNTPNKQSLSIRCARVGGVEIPANKRIEYSLQYIHGIGRTRARQILVDLQMENKITKDMAEEELIILRDEVSKYMIEGDLRRFNALAIKRLKEIQCYRGVRHIQGLPCRGQRTKNNCRTLKGKKIAIAGKKKVSK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	VAMPVAHSLSLICNW CHHHHHHHHHHHHHH	15.20	28295753
14	Phosphorylation	MPVAHSLSLICNWAK HHHHHHHHHHHHHHH	20.78	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RR13_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RR13_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RR13_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RR13_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.