UniProt ID | RPF2_MOUSE | |
---|---|---|
UniProt AC | Q9JJ80 | |
Protein Name | Ribosome production factor 2 homolog | |
Gene Name | Rpf2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 306 | |
Subcellular Localization | Nucleus, nucleolus . Associated with the nucleolus in an RNA-dependent manner. | |
Protein Description | Involved in ribosomal large subunit assembly. May regulate the localization of the 5S RNP/5S ribonucleoprotein particle to the nucleolus.. | |
Protein Sequence | MDALDKVLKPKTKRAKRFLEKREPKLTENIKNAMLIKGGNANATVTQVLRDMYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIEKFVSLKDIKTSKCPEGTKPMLIFAGDDFDVTEDFRRLKNLLIDFFRGPTVSNVRLAGLEYVLHFTALNGKVYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVMRRTHLASDDLYKLSMKVPKALKPKKRKNISQDTFGTTFGRIHMQKQDLSKLQTRKMKGLKKRPAENGVDDQGKKSKRIKKN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
59 | Phosphorylation | MYALKKPYGVLYKKK HHHHHCCCEEEEECC | 28.84 | 27357545 | |
63 | Phosphorylation | KKPYGVLYKKKNITR HCCCEEEEECCCCCC | 20.53 | 27357545 | |
160 | Acetylation | TEDFRRLKNLLIDFF CHHHHHHHHHHHHHH | 43.68 | 22826441 | |
255 | Phosphorylation | PKKRKNISQDTFGTT CCCCCCCCCCCCHHH | 31.25 | 28066266 | |
258 | Phosphorylation | RKNISQDTFGTTFGR CCCCCCCCCHHHHHH | 19.14 | 28066266 | |
261 | Phosphorylation | ISQDTFGTTFGRIHM CCCCCCHHHHHHHHH | 18.11 | 28066266 | |
262 | Phosphorylation | SQDTFGTTFGRIHMQ CCCCCHHHHHHHHHC | 25.19 | 28066266 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RPF2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPF2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPF2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RPF2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...