dbPTM

RPF2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RPF2_MOUSE
UniProt AC	Q9JJ80
Protein Name	Ribosome production factor 2 homolog
Gene Name	Rpf2
Organism	Mus musculus (Mouse).
Sequence Length	306
Subcellular Localization	Nucleus, nucleolus . Associated with the nucleolus in an RNA-dependent manner.
Protein Description	Involved in ribosomal large subunit assembly. May regulate the localization of the 5S RNP/5S ribonucleoprotein particle to the nucleolus..
Protein Sequence	MDALDKVLKPKTKRAKRFLEKREPKLTENIKNAMLIKGGNANATVTQVLRDMYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIEKFVSLKDIKTSKCPEGTKPMLIFAGDDFDVTEDFRRLKNLLIDFFRGPTVSNVRLAGLEYVLHFTALNGKVYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVMRRTHLASDDLYKLSMKVPKALKPKKRKNISQDTFGTTFGRIHMQKQDLSKLQTRKMKGLKKRPAENGVDDQGKKSKRIKKN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
59	Phosphorylation	MYALKKPYGVLYKKK HHHHHCCCEEEEECC	28.84	27357545
63	Phosphorylation	KKPYGVLYKKKNITR HCCCEEEEECCCCCC	20.53	27357545
160	Acetylation	TEDFRRLKNLLIDFF CHHHHHHHHHHHHHH	43.68	22826441
255	Phosphorylation	PKKRKNISQDTFGTT CCCCCCCCCCCCHHH	31.25	28066266
258	Phosphorylation	RKNISQDTFGTTFGR CCCCCCCCCHHHHHH	19.14	28066266
261	Phosphorylation	ISQDTFGTTFGRIHM CCCCCCHHHHHHHHH	18.11	28066266
262	Phosphorylation	SQDTFGTTFGRIHMQ CCCCCHHHHHHHHHC	25.19	28066266

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RPF2_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RPF2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RPF2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RPF2_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RPF2_MOUSE

Related Literatures of Post-Translational Modification