RPAC2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RPAC2_DROME
• UniProt AC: Q9VIZ0
• Protein Name: Probable DNA-directed RNA polymerases I and III subunit RPAC2
• Gene Name: l(2)37Cg
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 105
• Subcellular Localization: Nucleus.
• Protein Description: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively (By similarity)..
• Protein Sequence: MGALAELAGDEKNGEGSRTFVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRDRAIDILKRGLEDLEGLCDHTIVTFEKEMAEFNAMKVEN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RPAC2_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RPAC2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RPAC2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RPAC2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
WASC4_DROME	CG13957	physical	14605208
SRC42_DROME	Src42A	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.