RPAB3_CAEEL - dbPTM
RPAB3_CAEEL - PTM Information in dbPTM
Basic Information of Protein
UniProt ID RPAB3_CAEEL
UniProt AC Q19826
Protein Name Probable DNA-directed RNA polymerases I, II, and III subunit RPABC3
Gene Name rpb-8
Organism Caenorhabditis elegans.
Sequence Length 148
Subcellular Localization Nucleus.
Protein Description DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively (By similarity)..
Protein Sequence MAGIIFDDMFKVKSVDPDGKKFDRVSRYFCDAESFKMELIIDINSQIYPLKQNDKVRLVLATTLREDGLADEGEYDPKAEYPRIKQYEYVMYGKVYRLEDDDTGTDGGKLAAYASFGGLLMRLKGEAINLHGFEVDMNLYLLMKKTDF
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of RPAB3_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of RPAB3_CAEEL !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of RPAB3_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of RPAB3_CAEEL !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of RPAB3_CAEEL

loading...

Related Literatures of Post-Translational Modification

TOP