RPAB2_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RPAB2_RAT
• UniProt AC: O88828
• Protein Name: DNA-directed RNA polymerases I, II, and III subunit RPABC2
• Gene Name: Polr2f
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 127
• Subcellular Localization: Nucleus.
• Protein Description: DNA-dependent RNA polymerases catalyze the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2F/RPB6 is part of the clamp element and together with parts of RPB1 and RPB2 forms a pocket to which the RPB4-RPB7 subcomplex binds (By similarity)..
• Protein Sequence: MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIISD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSDNEDNFD ------CCCCCCCCC	49.49	-
2	Phosphorylation	------MSDNEDNFD ------CCCCCCCCC	49.49	10393248

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
2	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
2	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
2	S	Phosphorylation	Kinase	CK2	-	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RPAB2_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RPAB2_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of RPAB2_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"A serine residue in the N-terminal acidic region of rat RPB6, one ofthe common subunits of RNA polymerases, is exclusively phosphorylatedby casein kinase II in vitro.";
Kayukawa K., Makino Y., Yogosawa S., Tamura T.;
Gene 234:139-147(1999).
Cited for: NUCLEOTIDE SEQUENCE [MRNA], AND PHOSPHORYLATION AT SER-2.
PubMed: 10393248