RPA43_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RPA43_SCHPO
• UniProt AC: O43036
• Protein Name: DNA-directed RNA polymerase I subunit rpa43
• Gene Name: rpa43
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 173
• Subcellular Localization: Nucleus, nucleolus.
• Protein Description: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. May be involved in recruitment of Pol I to rDNA promoters..
• Protein Sequence: MPDLSLYKQTVDLYLSIAPGHSRDPLNAIQEHMDSMILSKLPRINGIVLAYDNIRFLEKSAKVMYDSPFSFIWVRVDVLVFSPKKGDCLEGKINLVSPSHIGLLILGIFNASIPRKSIPKDWIFIEPDTTEEQGRWKTNDGNILEPGKDLEFVVDGIQREAGLTMVQGTLANS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RPA43_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RPA43_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RPA43_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RPA43_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RRN3_SCHPO	rrn3	genetic	12207036
RPA14_SCHPO	ker1	physical	15647272
RPA14_SCHPO	ker1	genetic	15647272

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.