| UniProt ID | ROM1_HUMAN | |
|---|---|---|
| UniProt AC | Q03395 | |
| Protein Name | Rod outer segment membrane protein 1 | |
| Gene Name | ROM1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 351 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
| Protein Description | May function as an adhesion molecule involved in stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. It is essential for disk morphogenesis.. | |
| Protein Sequence | MAPVLPLVLPLQPRIRLAQGLWLLSWLLALAGGVILLCSGHLLVQLRHLGTFLAPSCQFPVLPQAALAAGAVALGTGLVGVGASRASLNAALYPPWRGVLGPLLVAGTAGGGGLLVVGLGLALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGSMLAVTFLLQALVLLGLRYLQTALEGLGGVIDAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSEA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 147 | Phosphorylation | ALAHYKDTEVPGHCQ HHHHCCCCCCCCCHH | 34.43 | - | |
| 201 | Phosphorylation | DVADRIQSNVEGLYL HHHHHHHHCCCCEEE | 40.24 | 22210691 | |
| 209 | Phosphorylation | NVEGLYLTDGVPFSC CCCCEEECCCCCCCC | 19.70 | 22210691 | |
| 215 | Phosphorylation | LTDGVPFSCCNPHSP ECCCCCCCCCCCCCC | 16.22 | 22210691 | |
| 288 | Phosphorylation | LVLLGLRYLQTALEG HHHHHHHHHHHHHHH | 14.27 | 22817900 | |
| 309 | Phosphorylation | AGGETQGYLFPSGLK CCCCCCCEECCCCHH | 8.71 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ROM1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ROM1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ROM1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SPTC2_HUMAN | SPTLC2 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...