UniProt ID | ROGDI_MOUSE | |
---|---|---|
UniProt AC | Q3TDK6 | |
Protein Name | Protein rogdi homolog | |
Gene Name | Rogdi | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 287 | |
Subcellular Localization | Nucleus envelope . Cell junction, synapse, presynaptic cell membrane . Cell projection, axon . Perikaryon . Cell projection, dendrite . Cytoplasmic vesicle, secretory vesicle, synaptic vesicle . Detected primarily at presynaptic sites on axons, and t | |
Protein Description | ||
Protein Sequence | MATAMAASAAERAVLEEEFRWLLHAEVHAVLRQLQDILKEASLRFTLPGPSTEGPAKQENFILGSCGTDQVKGTLTLQGDALSQADVNLKMPRNNQLLHLAFREDKQWKLQQIQDARNHVSQAIYLLANRDESYQFKTGAEVLKLMDAVMLQLTRARSRLTTPATLTLPEIAASGLTRMFAPTLPSDLLVNVYINLNKLCLTVYQLHALQPTSTKNFRPAGGAVLHSPGAMFEWGSQRLEVSHVHKVECVIPWLNDALVYFTVSLQLCQQLKDKIAVFSSYWSSRPF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MATAMAASA ------CHHHHHHHH | 12.22 | - | |
93 | Methylation | DVNLKMPRNNQLLHL CEEEECCCCCEEHHH | 51.76 | 30989235 | |
227 | Phosphorylation | AGGAVLHSPGAMFEW CCCEEEECCCCCCCC | 22.37 | 21930439 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ROGDI_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ROGDI_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ROGDI_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ROGDI_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...