dbPTM

RNF5_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RNF5_CAEEL
UniProt AC	Q09463
Protein Name	RING finger protein 5
Gene Name	rnf-5
Organism	Caenorhabditis elegans.
Sequence Length	235
Subcellular Localization
Protein Description
Protein Sequence	MASETKAPSEEPTSSSNKDESARFECNICLDAAKDAVVSLCGHLFCWPCLSQWLDTRPNNQVCPVCKSAIDGNKVVPIYGRGGDSSDPRKKVPPRPKGQRSEPPPQSFAGFNWGGDGGMMGGGGPNVHFSFGIGTVNGLFPLMFMLPFIQGIFPLSFVASFFGNGNQGAAAAGGGNGGGNDGNDGTHAHTHGHTHGPRGHGESAAPGSRMAQEEEYLSNIFKYIGFFMLFWLLFV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RNF5_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RNF5_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RNF5_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RNF5_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
PAXI_HUMAN	PXN	physical	12861019
UBC_HUMAN	UBC	physical	12861019

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RNF5_CAEEL

Related Literatures of Post-Translational Modification