| UniProt ID | RNF24_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y225 | |
| Protein Name | RING finger protein 24 | |
| Gene Name | RNF24 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 148 | |
| Subcellular Localization |
Golgi apparatus membrane Single-pass membrane protein . |
|
| Protein Description | May play a role in TRPCs intracellular trafficking.. | |
| Protein Sequence | MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGPLPGAENIV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 55 | Ubiquitination | RLRHQAHKEFYAYKQ HHHHHHHHHHHHHHH | 53.16 | 23000965 | |
| 60 | Phosphorylation | AHKEFYAYKQVILKE HHHHHHHHHHHHHHH | 7.20 | 24961811 | |
| 61 | Ubiquitination | HKEFYAYKQVILKEK HHHHHHHHHHHHHHH | 29.89 | 23000965 | |
| 66 | Ubiquitination | AYKQVILKEKVKELN HHHHHHHHHHHHHCC | 44.35 | 23000965 | |
| 70 | Ubiquitination | VILKEKVKELNLHEL HHHHHHHHHCCHHHH | 68.50 | 23000965 | |
| 76 | Ubiquitination | VKELNLHELCAVCLE HHHCCHHHHHHHHHH | 49.03 | 21890473 | |
| 81 | Ubiquitination | LHELCAVCLEDFKPR HHHHHHHHHHHCCCH | 1.51 | 23000965 | |
| 82 (in isoform 2) | Ubiquitination | - | 5.94 | - | |
| 82 | Ubiquitination | HELCAVCLEDFKPRD HHHHHHHHHHCCCHH | 5.94 | 23000965 | |
| 87 | Ubiquitination | VCLEDFKPRDELGIC HHHHHCCCHHHCCCC | 49.28 | 23000965 | |
| 91 | Ubiquitination | DFKPRDELGICPCKH HCCCHHHCCCCCCCC | 7.02 | 29901268 | |
| 97 | Ubiquitination | ELGICPCKHAFHRKC HCCCCCCCCHHHHHH | 24.10 | 32015554 | |
| 103 | Ubiquitination | CKHAFHRKCLIKWLE CCCHHHHHHHHHHHH | 25.48 | 23000965 | |
| 107 | Ubiquitination | FHRKCLIKWLEVRKV HHHHHHHHHHHHHCC | 32.55 | 23000965 | |
| 113 | Ubiquitination | IKWLEVRKVCPLCNM HHHHHHHCCCHHCCC | 54.05 | 23000965 | |
| 118 | Ubiquitination | VRKVCPLCNMPVLQL HHCCCHHCCCHHHHH | 2.18 | 23000965 | |
| 122 | Ubiquitination | CPLCNMPVLQLAQLH CHHCCCHHHHHHHHH | 3.56 | 23000965 | |
| 124 | Ubiquitination | LCNMPVLQLAQLHSK HCCCHHHHHHHHHCC | 34.68 | 23000965 | |
| 128 (in isoform 2) | Ubiquitination | - | 4.02 | - | |
| 128 | Ubiquitination | PVLQLAQLHSKQDRG HHHHHHHHHCCCCCC | 4.02 | 23000965 | |
| 134 | Ubiquitination | QLHSKQDRGPPQGPL HHHCCCCCCCCCCCC | 57.96 | 23000965 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RNF24_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RNF24_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RNF24_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RNF24_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
