RNF14_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RNF14_MOUSE
• UniProt AC: Q9JI90
• Protein Name: E3 ubiquitin-protein ligase RNF14
• Gene Name: Rnf14
• Organism: Mus musculus (Mouse).
• Sequence Length: 485
• Subcellular Localization: Cytoplasm. Nucleus.
• Protein Description: Might act as an E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates, which could be nuclear proteins. Could play a role as a coactivator for androgen- and, to a lesser extent, progesterone-dependent transcription (By similarity)..
• Protein Sequence: MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQASSSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCSICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLEKNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRLFHAVDINGDMWEDEIEEDDDDEDDDDD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
257	Ubiquitination	DYFEIQIKDGQVKCL HHEEEEEECCCEEEC	39.16	22790023
349	Phosphorylation	RLTYHGLSPCKVTAE HHHHCCCCCCCCCHH	32.61	26824392
352	Ubiquitination	YHGLSPCKVTAEKLI HCCCCCCCCCHHHHH	46.10	22790023
357	Ubiquitination	PCKVTAEKLIDLRNE CCCCCHHHHHHHHHH	48.56	22790023
400	Succinylation	ESKDWLEKNSKSCPC HCHHHHHHHCCCCCC	65.43	23954790
400	Ubiquitination	ESKDWLEKNSKSCPC HCHHHHHHHCCCCCC	65.43	-
450	Phosphorylation	PYRHFTDSESPCFNR CCCCCCCCCCCHHHH	36.60	20415495
452	Phosphorylation	RHFTDSESPCFNRLF CCCCCCCCCHHHHHC	30.81	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RNF14_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RNF14_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RNF14_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.