UniProt ID | RNF14_MOUSE | |
---|---|---|
UniProt AC | Q9JI90 | |
Protein Name | E3 ubiquitin-protein ligase RNF14 | |
Gene Name | Rnf14 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 485 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | Might act as an E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates, which could be nuclear proteins. Could play a role as a coactivator for androgen- and, to a lesser extent, progesterone-dependent transcription (By similarity).. | |
Protein Sequence | MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQASSSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCSICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLEKNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRLFHAVDINGDMWEDEIEEDDDDEDDDDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
257 | Ubiquitination | DYFEIQIKDGQVKCL HHEEEEEECCCEEEC | 39.16 | 22790023 | |
349 | Phosphorylation | RLTYHGLSPCKVTAE HHHHCCCCCCCCCHH | 32.61 | 26824392 | |
352 | Ubiquitination | YHGLSPCKVTAEKLI HCCCCCCCCCHHHHH | 46.10 | 22790023 | |
357 | Ubiquitination | PCKVTAEKLIDLRNE CCCCCHHHHHHHHHH | 48.56 | 22790023 | |
400 | Succinylation | ESKDWLEKNSKSCPC HCHHHHHHHCCCCCC | 65.43 | 23954790 | |
400 | Ubiquitination | ESKDWLEKNSKSCPC HCHHHHHHHCCCCCC | 65.43 | - | |
450 | Phosphorylation | PYRHFTDSESPCFNR CCCCCCCCCCCHHHH | 36.60 | 20415495 | |
452 | Phosphorylation | RHFTDSESPCFNRLF CCCCCCCCCHHHHHC | 30.81 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RNF14_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RNF14_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RNF14_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...