RNAS4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RNAS4_HUMAN
• UniProt AC: P34096
• Protein Name: Ribonuclease 4
• Gene Name: RNASE4
• Organism: Homo sapiens (Human).
• Sequence Length: 147
• Subcellular Localization: Secreted.
• Protein Description: This RNase has marked specificity towards the 3' side of uridine nucleotides..
• Protein Sequence: MALQRTHSLLLLLLLTLLGLGLVQPSYGQDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
29	Pyrrolidone_carboxylic_acid	LVQPSYGQDGMYQRF CCCCCCCCCCHHHHH	35.53	-
29	Pyrrolidone_carboxylic_acid	LVQPSYGQDGMYQRF CCCCCCCCCCHHHHH	35.53	8223579
29	Pyrrolidone_carboxylic_acid	LVQPSYGQDGMYQRF CCCCCCCCCCHHHHH	35.53	8223579
127	Phosphorylation	CRYRAIASTRRVVIA HHEEEEEECCEEEEE	19.14	28634120

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RNAS4_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RNAS4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RNAS4_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of RNAS4_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.