UniProt ID | RNAS1_HUMAN | |
---|---|---|
UniProt AC | P07998 | |
Protein Name | Ribonuclease pancreatic | |
Gene Name | RNASE1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 156 | |
Subcellular Localization | Secreted. | |
Protein Description | Endonuclease that catalyzes the cleavage of RNA on the 3' side of pyrimidine nucleotides. Acts on single-stranded and double-stranded RNA.. | |
Protein Sequence | MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
26 | Phosphorylation | VLGWVQPSLGKESRA HHHHHCHHCCHHHHH | 32.44 | 24114839 | |
49 | Phosphorylation | DSDSSPSSSSTYCNQ CCCCCCCCHHHHHHH | 31.52 | - | |
62 | N-linked_Glycosylation | NQMMRRRNMTQGRCK HHHHHHCCCCCCCCC | 35.72 | 12626415 | |
62 | N-linked_Glycosylation | NQMMRRRNMTQGRCK HHHHHHCCCCCCCCC | 35.72 | 12626415 | |
92 | Phosphorylation | VCFQEKVTCKNGQGN EEEEEEEEEECCCCC | 28.91 | 29978859 | |
104 | N-linked_Glycosylation | QGNCYKSNSSMHITD CCCCEECCCCCEEEE | 33.67 | 12626415 | |
104 | N-linked_Glycosylation | QGNCYKSNSSMHITD CCCCEECCCCCEEEE | 33.67 | 12626415 | |
115 | Phosphorylation | HITDCRLTNGSRYPN EEEEEECCCCCCCCC | 20.41 | 30576142 | |
116 | N-linked_Glycosylation | ITDCRLTNGSRYPNC EEEEECCCCCCCCCC | 51.54 | 12626415 | |
116 | N-linked_Glycosylation | ITDCRLTNGSRYPNC EEEEECCCCCCCCCC | 51.54 | 12626415 | |
120 | Phosphorylation | RLTNGSRYPNCAYRT ECCCCCCCCCCCCCC | 10.65 | 30576142 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RNAS1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RNAS1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RNAS1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RINI_HUMAN | RNH1 | physical | 28514442 | |
BUD31_HUMAN | BUD31 | physical | 28514442 | |
NMNA1_HUMAN | NMNAT1 | physical | 28514442 | |
ASHWN_HUMAN | C2orf49 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Differences in glycosylation pattern of human secretoryribonucleases."; Beintema J.J., Blank A., Schieven G.L., Dekker C.A., Sorrentino S.,Libonati M.; Biochem. J. 255:501-505(1988). Cited for: PROTEIN SEQUENCE OF 29-156, AND GLYCOSYLATION AT ASN-62; ASN-104 ANDASN-116. |