| UniProt ID | RN185_MOUSE | |
|---|---|---|
| UniProt AC | Q91YT2 | |
| Protein Name | E3 ubiquitin-protein ligase RNF185 | |
| Gene Name | Rnf185 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 192 | |
| Subcellular Localization |
Mitochondrion outer membrane Multi-pass membrane protein . Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | E3 ubiquitin-protein ligase that regulates selective mitochondrial autophagy by mediating 'Lys-63'-linked polyubiquitination of BNIP1. Acts in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway, which targets misfolded proteins that accumulate in the endoplasmic reticulum (ER) for ubiquitination and subsequent proteasome-mediated degradation. Protects cells from ER stress-induced apoptosis. Responsible for the cotranslational ubiquitination and degradation of CFTR in the ERAD pathway. Preferentially associates with the E2 enzymes UBE2J1 and UBE2J2 (By similarity).. | |
| Protein Sequence | MASKGPSASASTENSNAGGPSGSSNGTGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 40 | Ubiquitination | QDSTFECNICLDTAK CCCCEEECEECHHHH | 22.32 | 27667366 | |
| 58 | Ubiquitination | ISLCGHLFCWPCLHQ HHHHHHHHHHHHHHH | 3.21 | 27667366 | |
| 80 | Ubiquitination | RQVCPVCKAGISRDK CCCCCCCCCCCCCCC | 50.29 | 22790023 | |
| 80 (in isoform 2) | Ubiquitination | - | 50.29 | 22790023 | |
| 87 | Ubiquitination | KAGISRDKVIPLYGR CCCCCCCCEEECCCC | 40.74 | 22790023 | |
| 87 (in isoform 2) | Ubiquitination | - | 40.74 | 22790023 | |
| 105 | Ubiquitination | GQQDPREKTPPRPQG CCCCCCCCCCCCCCC | 68.55 | 22790023 | |
| 105 (in isoform 2) | Ubiquitination | - | 68.55 | 22790023 | |
| 106 | Phosphorylation | QQDPREKTPPRPQGQ CCCCCCCCCCCCCCC | 33.50 | 25159016 | |
| 116 (in isoform 2) | Ubiquitination | - | 68.39 | - | |
| 123 | Ubiquitination | EPENRGGFQGFGFGD CCCCCCCCCCCCCCC | 7.75 | 27667366 | |
| 123 (in isoform 2) | Ubiquitination | - | 7.75 | - | |
| 141 | Ubiquitination | QMSFGIGAFPFGIFA CEEEEECCCCCEEEE | 13.66 | 27667366 | |
| 141 (in isoform 2) | Ubiquitination | - | 13.66 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RN185_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RN185_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RN185_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RN185_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
