dbPTM

RN170_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RN170_MOUSE
UniProt AC	Q8CBG9
Protein Name	E3 ubiquitin-protein ligase RNF170
Gene Name	Rnf170
Organism	Mus musculus (Mouse).
Sequence Length	286
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein .
Protein Description	E3 ubiquitin-protein ligase that plays an essential role in stimulus-induced inositol 1,4,5-trisphosphate receptor type 1 (ITPR1) ubiquitination and degradation via the endoplasmic reticulum-associated degradation (ERAD) pathway. Also involved in ITPR1 turnover in resting cells..
Protein Sequence	MQRYWRFQDNKIQDICFGVLGESWIQRPVMARYYSEGQSLQQDDSFIEGVSDQVLVAVVVSLALTATLLYALLRNVQQNIHPENQELVRVLREQFQTEQDVPAPARQQFYTEMYCPICLHQASFPVETNCGHLFCGSCIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVIRLRQDVNDYNRRFSGQPRSIMERIMDLPTLLRHAFREVFSVGGLFWMFRIRIMLCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RN170_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RN170_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RN170_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RN170_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ERLN2_MOUSE	Erlin2	physical	21610068

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RN170_MOUSE

Related Literatures of Post-Translational Modification