RN170_MOUSE - dbPTM
RN170_MOUSE - PTM Information in dbPTM
Basic Information of Protein
UniProt ID RN170_MOUSE
UniProt AC Q8CBG9
Protein Name E3 ubiquitin-protein ligase RNF170
Gene Name Rnf170
Organism Mus musculus (Mouse).
Sequence Length 286
Subcellular Localization Endoplasmic reticulum membrane
Multi-pass membrane protein .
Protein Description E3 ubiquitin-protein ligase that plays an essential role in stimulus-induced inositol 1,4,5-trisphosphate receptor type 1 (ITPR1) ubiquitination and degradation via the endoplasmic reticulum-associated degradation (ERAD) pathway. Also involved in ITPR1 turnover in resting cells..
Protein Sequence MQRYWRFQDNKIQDICFGVLGESWIQRPVMARYYSEGQSLQQDDSFIEGVSDQVLVAVVVSLALTATLLYALLRNVQQNIHPENQELVRVLREQFQTEQDVPAPARQQFYTEMYCPICLHQASFPVETNCGHLFCGSCIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVIRLRQDVNDYNRRFSGQPRSIMERIMDLPTLLRHAFREVFSVGGLFWMFRIRIMLCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of RN170_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of RN170_MOUSE !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of RN170_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of RN170_MOUSE !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
ERLN2_MOUSEErlin2physical
21610068

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of RN170_MOUSE

loading...

Related Literatures of Post-Translational Modification

TOP