UniProt ID | RN133_HUMAN | |
---|---|---|
UniProt AC | Q8WVZ7 | |
Protein Name | E3 ubiquitin-protein ligase RNF133 | |
Gene Name | RNF133 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 376 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . |
|
Protein Description | Has E3 ubiquitin-protein ligase activity.. | |
Protein Sequence | MHLLKVGTWRNNTASSWLMKFSVLWLVSQNCCRASVVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNACNPNTIFSRSKYSETWLALIERGGCTFTQKIKVATEKGASGVIIYNVPGTGNQVFPMFHQAFEDVVVVMIGNLKGTEIFHLIKKGVLITAVVEVGRKHIIWMNHYLVSFVIVTTATLAYFIFYHIHRLCLARIQNRRWQRLTTDLQNTFGQLQLRVVKEGDEEINPNGDSCVICFERYKPNDIVRILTCKHFFHKNCIDPWILPHGTCPICKCDILKVLGIQVVVENGTEPLQVLMSNELPETLSPSEEETNNEVSPAGTSDKVIHVEENPTSQNNDIQPHSVVEDVHPSP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Phosphorylation | FSVLWLVSQNCCRAS HHHHHHHHCCCHHHH | 17.32 | - | |
65 | O-linked_Glycosylation | ETGVFGRSSTLKRVA CCCCCCCCCCCEEEE | 28.23 | 30620550 | |
66 | O-linked_Glycosylation | TGVFGRSSTLKRVAG CCCCCCCCCCEEEEC | 36.08 | 30620550 | |
227 | Phosphorylation | NRRWQRLTTDLQNTF HHHHHHHHHHHHHHH | 22.06 | 27174698 | |
228 | Phosphorylation | RRWQRLTTDLQNTFG HHHHHHHHHHHHHHC | 39.03 | 27174698 | |
233 | Phosphorylation | LTTDLQNTFGQLQLR HHHHHHHHHCCEEEE | 19.04 | 27174698 | |
346 | Phosphorylation | EVSPAGTSDKVIHVE CCCCCCCCCCEEEEE | 34.22 | 17081983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RN133_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RN133_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RN133_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RN133_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...