dbPTM

RN133_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RN133_HUMAN
UniProt AC	Q8WVZ7
Protein Name	E3 ubiquitin-protein ligase RNF133
Gene Name	RNF133
Organism	Homo sapiens (Human).
Sequence Length	376
Subcellular Localization	Endoplasmic reticulum membrane Single-pass membrane protein .
Protein Description	Has E3 ubiquitin-protein ligase activity..
Protein Sequence	MHLLKVGTWRNNTASSWLMKFSVLWLVSQNCCRASVVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNACNPNTIFSRSKYSETWLALIERGGCTFTQKIKVATEKGASGVIIYNVPGTGNQVFPMFHQAFEDVVVVMIGNLKGTEIFHLIKKGVLITAVVEVGRKHIIWMNHYLVSFVIVTTATLAYFIFYHIHRLCLARIQNRRWQRLTTDLQNTFGQLQLRVVKEGDEEINPNGDSCVICFERYKPNDIVRILTCKHFFHKNCIDPWILPHGTCPICKCDILKVLGIQVVVENGTEPLQVLMSNELPETLSPSEEETNNEVSPAGTSDKVIHVEENPTSQNNDIQPHSVVEDVHPSP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
28	Phosphorylation	FSVLWLVSQNCCRAS HHHHHHHHCCCHHHH	17.32	-
65	O-linked_Glycosylation	ETGVFGRSSTLKRVA CCCCCCCCCCCEEEE	28.23	30620550
66	O-linked_Glycosylation	TGVFGRSSTLKRVAG CCCCCCCCCCEEEEC	36.08	30620550
227	Phosphorylation	NRRWQRLTTDLQNTF HHHHHHHHHHHHHHH	22.06	27174698
228	Phosphorylation	RRWQRLTTDLQNTFG HHHHHHHHHHHHHHC	39.03	27174698
233	Phosphorylation	LTTDLQNTFGQLQLR HHHHHHHHHCCEEEE	19.04	27174698
346	Phosphorylation	EVSPAGTSDKVIHVE CCCCCCCCCCEEEEE	34.22	17081983

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RN133_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RN133_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RN133_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RN133_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RN133_HUMAN

Related Literatures of Post-Translational Modification