UniProt ID | RN114_MOUSE | |
---|---|---|
UniProt AC | Q9ET26 | |
Protein Name | E3 ubiquitin-protein ligase RNF114 | |
Gene Name | Rnf114 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 229 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | E3 ubiquitin-protein ligase promoting the ubiquitination and degradation of the CDK inhibitor CDKN1A and probably also CDKN1B and CDKN1C. These activities stimulate cell cycle's G1-to-S phase transition and suppress cellular senescence. May play a role in spermatogenesis.. | |
Protein Sequence | MAAAQPESRDGAAQSAKPASETDPLSRFTCPVCLEVFEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSALAPGVRAVELERQIESIETSCHGCRKNFILSKIRAHVTSCSKYQNYIMEGVKATTKDASLQPRNIPNRYTFPCPYCPEKNFDQEGLVEHCKLTHSTDTKSVVCPICASMPWGDPSYRSANFMEHIQRRHRFSYDTFVDYDVDEDDMINQVLQRSIIDQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Ubiquitination | DGAAQSAKPASETDP CCCCCCCCCCCCCCC | 46.49 | 27667366 | |
61 | Ubiquitination | LQECLKPKKPVCGVC HHHHHCCCCCCCHHH | 69.03 | - | |
62 | Ubiquitination | QECLKPKKPVCGVCR HHHHCCCCCCCHHHH | 51.73 | - | |
62 | Malonylation | QECLKPKKPVCGVCR HHHHCCCCCCCHHHH | 51.73 | 32601280 | |
65 | Glutathionylation | LKPKKPVCGVCRSAL HCCCCCCCHHHHHHC | 4.60 | 24333276 | |
97 | Ubiquitination | TSCHGCRKNFILSKI HHHCHHHHHHHHHHH | 61.35 | - | |
97 | Malonylation | TSCHGCRKNFILSKI HHHCHHHHHHHHHHH | 61.35 | 26320211 | |
103 | Acetylation | RKNFILSKIRAHVTS HHHHHHHHHHHHHHH | 32.53 | - | |
103 | Ubiquitination | RKNFILSKIRAHVTS HHHHHHHHHHHHHHH | 32.53 | - | |
113 | Acetylation | AHVTSCSKYQNYIME HHHHHHHHHHHHHHH | 56.00 | - | |
117 | Phosphorylation | SCSKYQNYIMEGVKA HHHHHHHHHHHHHHE | 6.01 | 29514104 | |
123 | Ubiquitination | NYIMEGVKATTKDAS HHHHHHHHEECCCCC | 51.37 | 27667366 | |
127 | Ubiquitination | EGVKATTKDASLQPR HHHHEECCCCCCCCC | 47.12 | 27667366 | |
161 | S-nitrosylation | QEGLVEHCKLTHSTD CCCHHHHHCCCCCCC | 2.15 | 21278135 | |
161 | S-nitrosocysteine | QEGLVEHCKLTHSTD CCCHHHHHCCCCCCC | 2.15 | - | |
162 | Ubiquitination | EGLVEHCKLTHSTDT CCHHHHHCCCCCCCC | 59.33 | - | |
187 | Phosphorylation | MPWGDPSYRSANFME CCCCCCCHHCHHHHH | 17.61 | - | |
189 | Phosphorylation | WGDPSYRSANFMEHI CCCCCHHCHHHHHHH | 21.23 | 28066266 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RN114_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RN114_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RN114_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RN114_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...