| UniProt ID | RMAR_YEAST | |
|---|---|---|
| UniProt AC | P02381 | |
| Protein Name | Ribosomal protein VAR1, mitochondrial | |
| Gene Name | VAR1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 398 | |
| Subcellular Localization | Mitochondrion . Mitoribosomes are tethered to the mitochondrial inner membrane and spatially aligned with the membrane insertion machinery through two distinct membrane contact sites, formed by the 21S rRNA expansion segment 96-ES1 and the inner memb | |
| Protein Description | Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane. [PubMed: 25609543] | |
| Protein Sequence | MKLKLLNMILSMMNKTNNNNNIIINNTLDSLMNKKLLLKNMLLDMNNKKMNNMKRMLNNNNMNPAGANPVVHRIGPAGNINNKLQHLNNMNNWNTQIYNYNKNMEIMNTMNDKLINKLLYKMMTLKLNNMNINKIIMSKTINQHSLNKLNIKFYYYNNDINNNNNNNNNNYYMNMMNKLMNIMNNNMNNNLCNILSYYYKKKVTIEPIKLSYIYLNSDIFSKYISLNDMDKYNNGILTNYQRMLNNIMPKLNDHNISMNYINNINNINNNKYNNMINLLNNNNNINNNNNYNNNNNNYIGNINNIYNNMTIDNIPMDILMYKYLVGWSIKFKGRLSNNNGRTSTTNLLNGTFNNKKYLWSNINNNYKLNYIPSNHNLYNNSNINKNGKYNIKVKLNFI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Phosphorylation | KLLNMILSMMNKTNN HHHHHHHHHHHHCCC | 12.69 | 28132839 | |
| 39 | Acetylation | MNKKLLLKNMLLDMN HCHHHHHHHHHHHCC | 40.04 | 25381059 | |
| 48 | Acetylation | MLLDMNNKKMNNMKR HHHHCCHHHHHHHHH | 48.68 | 25381059 | |
| 370 | Phosphorylation | NNNYKLNYIPSNHNL CCCEEEEECCCCCCC | 25.33 | 29688323 | |
| 373 | Phosphorylation | YKLNYIPSNHNLYNN EEEEECCCCCCCCCC | 40.96 | 29688323 | |
| 378 | Phosphorylation | IPSNHNLYNNSNINK CCCCCCCCCCCCCCC | 20.02 | 29688323 | |
| 381 | Phosphorylation | NHNLYNNSNINKNGK CCCCCCCCCCCCCCC | 35.13 | 29688323 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RMAR_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RMAR_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RMAR_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SUV3_YEAST | SUV3 | genetic | 2698840 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...