dbPTM

RMA1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RMA1_ARATH
UniProt AC	O64425
Protein Name	E3 ubiquitin-protein ligase RMA1
Gene Name	RMA1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	249
Subcellular Localization	Endoplasmic reticulum membrane Single-pass type IV membrane protein .
Protein Description	E3 ubiquitin-protein ligase that promotes the ubiquitination and proteasomal degradation of aquaporin PIP2-1. Forms a ubiquitin ligase complex in cooperation with the E2 enzymes UCB8/UCB10..
Protein Sequence	MALDQSFEDAALLGELYGEGAFCFKSKKPEPITVSVPSDDTDDSNFDCNICLDSVQEPVVTLCGHLFCWPCIHKWLDVQSFSTSDEYQRHRQCPVCKSKVSHSTLVPLYGRGRCTTQEEGKNSVPKRPVGPVYRLEMPNSPYASTDLRLSQRVHFNSPQEGYYPVSGVMSSNSLSYSAVLDPVMVMVGEMVATRLFGTRVMDRFAYPDTYNLAGTSGPRMRRRIMQADKSLGRIFFFFMCCVVLCLLLF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
140	Phosphorylation	YRLEMPNSPYASTDL EEEECCCCCCCCCCE	17.26	27545962
142	Phosphorylation	LEMPNSPYASTDLRL EECCCCCCCCCCEEH	17.01	27545962
144	Phosphorylation	MPNSPYASTDLRLSQ CCCCCCCCCCEEHHH	19.33	27545962
145	Phosphorylation	PNSPYASTDLRLSQR CCCCCCCCCEEHHHC	30.77	27545962
209	Phosphorylation	DRFAYPDTYNLAGTS HHCCCCCCCCCCCCC	15.14	23660473
215	Phosphorylation	DTYNLAGTSGPRMRR CCCCCCCCCCHHHHH	25.55	23660473

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RMA1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RMA1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RMA1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RMA1_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RMA1_ARATH

Related Literatures of Post-Translational Modification