| UniProt ID | RM41_MOUSE | |
|---|---|---|
| UniProt AC | Q9CQN7 | |
| Protein Name | 39S ribosomal protein L41, mitochondrial | |
| Gene Name | Mrpl41 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 135 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Component of the mitochondrial ribosome large subunit. Also involved in apoptosis and cell cycle. Enhances p53/TP53 stability, thereby contributing to p53/TP53-induced apoptosis in response to growth-inhibitory condition. Enhances p53/TP53 translocation to the mitochondria. Has the ability to arrest the cell cycle at the G1 phase, possibly by stabilizing the CDKN1A and CDKN1B (p27Kip1) proteins.. | |
| Protein Sequence | MGFLTAVTQGLVRGADRMSKWTSKRGPRTFTKSRGAKKTGIYTSDRKFVQIKEMVPEFVVPDLTGFKLKPYVNYRAPAGIDTPLTAKALFQETVAPAIEKDFKEGTFDANNLEKYGFEPTQEGKLFQLYPKNFPR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 67 | Acetylation | VPDLTGFKLKPYVNY CCCCCCCCEECCCCC | 57.87 | 66697991 | |
| 100 | Acetylation | TVAPAIEKDFKEGTF CHHHHHHHHHHCCCC | 63.45 | 66702433 | |
| 103 | Acetylation | PAIEKDFKEGTFDAN HHHHHHHHCCCCCCC | 66.42 | 23864654 | |
| 103 | Succinylation | PAIEKDFKEGTFDAN HHHHHHHHCCCCCCC | 66.42 | 23954790 | |
| 114 | Acetylation | FDANNLEKYGFEPTQ CCCCCHHHCCCCCCC | 54.57 | 23954790 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RM41_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RM41_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RM41_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RM41_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
