UniProt ID | RM41_MOUSE | |
---|---|---|
UniProt AC | Q9CQN7 | |
Protein Name | 39S ribosomal protein L41, mitochondrial | |
Gene Name | Mrpl41 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 135 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Component of the mitochondrial ribosome large subunit. Also involved in apoptosis and cell cycle. Enhances p53/TP53 stability, thereby contributing to p53/TP53-induced apoptosis in response to growth-inhibitory condition. Enhances p53/TP53 translocation to the mitochondria. Has the ability to arrest the cell cycle at the G1 phase, possibly by stabilizing the CDKN1A and CDKN1B (p27Kip1) proteins.. | |
Protein Sequence | MGFLTAVTQGLVRGADRMSKWTSKRGPRTFTKSRGAKKTGIYTSDRKFVQIKEMVPEFVVPDLTGFKLKPYVNYRAPAGIDTPLTAKALFQETVAPAIEKDFKEGTFDANNLEKYGFEPTQEGKLFQLYPKNFPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
67 | Acetylation | VPDLTGFKLKPYVNY CCCCCCCCEECCCCC | 57.87 | 66697991 | |
100 | Acetylation | TVAPAIEKDFKEGTF CHHHHHHHHHHCCCC | 63.45 | 66702433 | |
103 | Acetylation | PAIEKDFKEGTFDAN HHHHHHHHCCCCCCC | 66.42 | 23864654 | |
103 | Succinylation | PAIEKDFKEGTFDAN HHHHHHHHCCCCCCC | 66.42 | 23954790 | |
114 | Acetylation | FDANNLEKYGFEPTQ CCCCCHHHCCCCCCC | 54.57 | 23954790 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RM41_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RM41_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RM41_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RM41_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...