RM23_CAEEL - dbPTM
RM23_CAEEL - PTM Information in dbPTM
Basic Information of Protein
UniProt ID RM23_CAEEL
UniProt AC Q9GYS9
Protein Name Probable 39S ribosomal protein L23, mitochondrial
Gene Name mrpl-23
Organism Caenorhabditis elegans.
Sequence Length 159
Subcellular Localization Mitochondrion .
Protein Description
Protein Sequence MTSRLARLWQPGNPQRRVFLPDFWMAVVESPSVGRNRLPRNCVKFEVDPRMSRHDIREYLTKIYDLPVRDVRTEVQMGDITWNSKLDHQYKKAMWKDEDKKIAYVFMSKGFEFSYPQMFEALEEDLELVKAMKQQEELKDKLNERYANRNRRVGQFLGA
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of RM23_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of RM23_CAEEL !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of RM23_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of RM23_CAEEL !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of RM23_CAEEL !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of RM23_CAEEL

loading...

Related Literatures of Post-Translational Modification

TOP