UniProt ID | RM21_MOUSE | |
---|---|---|
UniProt AC | Q9D1N9 | |
Protein Name | 39S ribosomal protein L21, mitochondrial | |
Gene Name | Mrpl21 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 209 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MAAAIAASALPGAFGRLVSVCSRSILASQGSGSASLWSASRRFNSQSASYPQGYVPKTSLSSPPWQEVVLPDPVEETRHHAEVVKRVNELIATGQYGRLFAVVHFASHQWKVTAEDLILIENELDIKCGERIRLEKVLLVGADNFTLLGKPLLRKELVRVEATVIEKTESWPKINMKFRKRKNFRKKKIIVNPQTILRINTIEIAPRLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | Phosphorylation | SASRRFNSQSASYPQ HHHHHHCCCCCCCCC | 23.85 | 26643407 | |
47 | Phosphorylation | SRRFNSQSASYPQGY HHHHCCCCCCCCCCC | 21.00 | 26643407 | |
49 | Phosphorylation | RFNSQSASYPQGYVP HHCCCCCCCCCCCCC | 42.46 | 26643407 | |
50 | Phosphorylation | FNSQSASYPQGYVPK HCCCCCCCCCCCCCC | 10.17 | 26643407 | |
54 | Phosphorylation | SASYPQGYVPKTSLS CCCCCCCCCCCCCCC | 14.34 | 26643407 | |
85 (in isoform 2) | Acetylation | - | 56.66 | - | |
85 | Acetylation | RHHAEVVKRVNELIA HHHHHHHHHHHHHHH | 56.66 | 23864654 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RM21_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RM21_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RM21_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RM21_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...