RM21_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RM21_MOUSE
• UniProt AC: Q9D1N9
• Protein Name: 39S ribosomal protein L21, mitochondrial
• Gene Name: Mrpl21
• Organism: Mus musculus (Mouse).
• Sequence Length: 209
• Subcellular Localization: Mitochondrion .
• Protein Sequence: MAAAIAASALPGAFGRLVSVCSRSILASQGSGSASLWSASRRFNSQSASYPQGYVPKTSLSSPPWQEVVLPDPVEETRHHAEVVKRVNELIATGQYGRLFAVVHFASHQWKVTAEDLILIENELDIKCGERIRLEKVLLVGADNFTLLGKPLLRKELVRVEATVIEKTESWPKINMKFRKRKNFRKKKIIVNPQTILRINTIEIAPRLL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
45	Phosphorylation	SASRRFNSQSASYPQ HHHHHHCCCCCCCCC	23.85	26643407
47	Phosphorylation	SRRFNSQSASYPQGY HHHHCCCCCCCCCCC	21.00	26643407
49	Phosphorylation	RFNSQSASYPQGYVP HHCCCCCCCCCCCCC	42.46	26643407
50	Phosphorylation	FNSQSASYPQGYVPK HCCCCCCCCCCCCCC	10.17	26643407
54	Phosphorylation	SASYPQGYVPKTSLS CCCCCCCCCCCCCCC	14.34	26643407
85 (in isoform 2)	Acetylation	-	56.66	-
85	Acetylation	RHHAEVVKRVNELIA HHHHHHHHHHHHHHH	56.66	23864654

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RM21_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RM21_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RM21_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RM21_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.