RM09_SCHPO - dbPTM
RM09_SCHPO - PTM Information in dbPTM
Basic Information of Protein
UniProt ID RM09_SCHPO
UniProt AC Q9P6P6
Protein Name 54S ribosomal protein L9, mitochondrial
Gene Name mrpl9
Organism Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length 259
Subcellular Localization Cytoplasm . Mitochondrion.
Protein Description
Protein Sequence MQSRFLISPTLIRTFAHHANLTPRKILHDLPEAAHARKQIPLRPGVILVKKGMTNAWDEKTGMQVPLTILQFDRVQAIDVRTKEKHGYYAVQVGSGIRKPKSITKAEQGNFFSHNIYPKMHVREFRVRDASGLVSPGTIFTTDYFKPKQYVDVKGITKGKGFAGVMKRWGFSGGNASHGASLSHRTPGSTGQNTTPSRVLPGRKMAGHMGHRSRTVKNLLVWAVDADLECILVKGSIPGPNKSAVYVTDTINRSTSATN
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of RM09_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of RM09_SCHPO !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of RM09_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of RM09_SCHPO !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of RM09_SCHPO !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of RM09_SCHPO

loading...

Related Literatures of Post-Translational Modification

TOP