dbPTM

RM01_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RM01_MOUSE
UniProt AC	Q99N96
Protein Name	39S ribosomal protein L1, mitochondrial
Gene Name	Mrpl1
Organism	Mus musculus (Mouse).
Sequence Length	336
Subcellular Localization	Mitochondrion.
Protein Description
Protein Sequence	MAAAVRCLRRVLIHHQRHCLCKMASQASLYPCSVNSLLHNRHFAAAAAAATKPARKIKKGAKEKTSDEKPVDDIEKIKSYTYMESDPEDDVYLKRLYPRRIYEVEKAIHLLKKFQVLDFTNPKQGVYLDLTLDMALGKKKTVEPFASVIALPHLFSSEVNKVAVFTANASEIKIAEENGAAFAGGTDLVKKIMDDEVVVDFYVAVPEIMGELNPLRKKLKKRFPKATRNSIGRDIPKMLELFKTAHEIMVDEERQNFLSTKIATLDMPSDQIAANLQAVINEVCKHRPLNLGPFVVRAFLRSSTSEGLLLKTDSLLPKEAKTTEAETEETQTAEAA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
63	Phosphorylation	KIKKGAKEKTSDEKP HHHCCCCCCCCCCCC	62.12	17242355
69	Acetylation	KEKTSDEKPVDDIEK CCCCCCCCCCCHHHH	56.16	23201123
79	Phosphorylation	DDIEKIKSYTYMESD CHHHHHHHHCCCCCC	26.61	23140645
81	Phosphorylation	IEKIKSYTYMESDPE HHHHHHHCCCCCCCC	24.39	22668510
82	Phosphorylation	EKIKSYTYMESDPED HHHHHHCCCCCCCCC	7.22	26239621
85	Phosphorylation	KSYTYMESDPEDDVY HHHCCCCCCCCCCCH	41.77	27818261
94	Succinylation	PEDDVYLKRLYPRRI CCCCCHHHHHCHHCH	23.75	23954790
106	Acetylation	RRIYEVEKAIHLLKK HCHHHHHHHHHHHHH	58.79	23201123
113	Acetylation	KAIHLLKKFQVLDFT HHHHHHHHCCEECCC	40.78	24062335
259	Phosphorylation	EERQNFLSTKIATLD HHHHHHHHCEEEECC	24.42	23140645
284	Glutathionylation	QAVINEVCKHRPLNL HHHHHHHHHCCCCCC	2.21	24333276

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RM01_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RM01_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RM01_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RM01_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RM01_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-85, AND MASSSPECTROMETRY.	17242355 [Abstract]