UniProt ID | RLP24_DROME | |
---|---|---|
UniProt AC | Q9VGN9 | |
Protein Name | Probable ribosome biogenesis protein RLP24 | |
Gene Name | RpL24-like | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 191 | |
Subcellular Localization | Nucleus, nucleolus. | |
Protein Description | Involved in the biogenesis of the 60S ribosomal subunit. Ensures the docking of NOG1 to pre-60S particles (By similarity).. | |
Protein Sequence | MRIQTCYFCSSKIYPGHGVQFVRNDCKVFKFCRGKCHKAFKRKKNPRKVGWTKAYRKAAGKELAIDPSFEFEKRRNVPMKYSRETWQKGLEAIKRVTEIKEKRTSHFVMERLRKGRQVEIQMDVKDVQRNMSLIRSPAAGLKQRRAQEAAEEAALMEEDLPEEKITYVDARELEKKLEEGMGVEDLEMLEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
61 | Acetylation | AYRKAAGKELAIDPS HHHHHCCCCCEECCC | 44.84 | 21791702 | |
88 | Acetylation | YSRETWQKGLEAIKR CCHHHHHHHHHHHHH | 57.96 | 21791702 | |
136 | Phosphorylation | RNMSLIRSPAAGLKQ HHHHHHHCHHHHHHH | 16.34 | 22817900 | |
142 | Acetylation | RSPAAGLKQRRAQEA HCHHHHHHHHHHHHH | 40.62 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RLP24_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RLP24_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RLP24_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RLP24_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...