RLF1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RLF1_ARATH
• UniProt AC: Q9SRY3
• Protein Name: Protein RALF-like 1
• Gene Name: RALF1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 120
• Subcellular Localization: Secreted .
• Protein Description: Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling events through a cell surface receptor and a concomitant activation of some intracellular mitogen-activated protein kinases. Mostly active in roots. Prevents plant growth (e.g. root and leaf length). Suppresses cell elongation of the primary root by activating the cell surface receptor FER and triggering phosphorylation of AHA2 and subsequent extracellular alkalinization..
• Protein Sequence: MDKSFTLFLTLTILVVFIISSPPVQAGFANDLGGVAWATTGDNGSGCHGSIAECIGAEEEEMDSEINRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCSKIARCRS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
43	N-linked_Glycosylation	AWATTGDNGSGCHGS EEEECCCCCCCCCCH		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RLF1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RLF1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RLF1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RLF1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.