UniProt ID | RLA4_SCHPO | |
---|---|---|
UniProt AC | P17478 | |
Protein Name | 60S acidic ribosomal protein P2-beta | |
Gene Name | rpp202 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 110 | |
Subcellular Localization | ||
Protein Description | Plays an important role in the elongation step of protein synthesis.. | |
Protein Sequence | MKYLAAYLLLTVGGKQSPSASDIESVLSTVGIEAEAERVESLISELNGKNIEELIAAGNEKLSTVPSAGAVATPAAGGAAGAEATSAAEEAKEEEAAEESDEDMGFGLFD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
67 | Phosphorylation | EKLSTVPSAGAVATP CCCCCCCCCCCCCCC | 34.69 | 29996109 | |
73 | Phosphorylation | PSAGAVATPAAGGAA CCCCCCCCCCCCCHH | 13.58 | 29996109 | |
85 | Phosphorylation | GAAGAEATSAAEEAK CHHHHHHHHHHHHHH | 15.48 | 21712547 | |
86 | Phosphorylation | AAGAEATSAAEEAKE HHHHHHHHHHHHHHH | 32.31 | 21712547 | |
100 | Phosphorylation | EEEAAEESDEDMGFG HHHHHHHCCCCCCCC | 37.49 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RLA4_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RLA4_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RLA4_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RLA4_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...