| UniProt ID | RLA2_RAT | |
|---|---|---|
| UniProt AC | P02401 | |
| Protein Name | 60S acidic ribosomal protein P2 | |
| Gene Name | Rplp2 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 115 | |
| Subcellular Localization | ||
| Protein Description | Plays an important role in the elongation step of protein synthesis.. | |
| Protein Sequence | MRYVASYLLAALGGNSNPSAKDIKKILDSVGIEADDERLNKVISELNGKNIEDVIAQGVGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MRYVASYL -------CHHHHHHH | 6.69 | - | |
| 6 | Phosphorylation | --MRYVASYLLAALG --CHHHHHHHHHHHC | 13.28 | 23984901 | |
| 7 | Phosphorylation | -MRYVASYLLAALGG -CHHHHHHHHHHHCC | 8.94 | 23984901 | |
| 16 | Phosphorylation | LAALGGNSNPSAKDI HHHHCCCCCCCHHHH | 54.08 | 27097102 | |
| 19 | Phosphorylation | LGGNSNPSAKDIKKI HCCCCCCCHHHHHHH | 52.80 | 27097102 | |
| 21 | Acetylation | GNSNPSAKDIKKILD CCCCCCHHHHHHHHH | 65.41 | 25786129 | |
| 21 | Succinylation | GNSNPSAKDIKKILD CCCCCCHHHHHHHHH | 65.41 | - | |
| 21 | Succinylation | GNSNPSAKDIKKILD CCCCCCHHHHHHHHH | 65.41 | - | |
| 25 | Acetylation | PSAKDIKKILDSVGI CCHHHHHHHHHHHCC | 49.16 | 22902405 | |
| 41 | Acetylation | ADDERLNKVISELNG CCHHHHHHHHHHHCC | 45.60 | 22902405 | |
| 49 | Acetylation | VISELNGKNIEDVIA HHHHHCCCCHHHHHH | 54.39 | 22902405 | |
| 61 | Acetylation | VIAQGVGKLASVPAG HHHHCCCHHHCCCCC | 38.17 | 22902405 | |
| 64 | Phosphorylation | QGVGKLASVPAGGAV HCCCHHHCCCCCCEE | 38.78 | 23984901 | |
| 74 | Phosphorylation | AGGAVAVSAAPGSAA CCCEEEEEECCCCCC | 14.69 | 23984901 | |
| 79 | Phosphorylation | AVSAAPGSAAPAAGS EEEECCCCCCCCCCC | 21.87 | 29779826 | |
| 86 | Phosphorylation | SAAPAAGSAPAAAEE CCCCCCCCCCHHHHH | 26.76 | 27097102 | |
| 94 | Acetylation | APAAAEEKKDEKKEE CCHHHHHHHHHHHHH | 57.96 | 22902405 | |
| 102 | Phosphorylation | KDEKKEESEESDDDM HHHHHHHCCCCCCCC | 47.99 | 19700791 | |
| 105 | Phosphorylation | KKEESEESDDDMGFG HHHHCCCCCCCCCCC | 42.14 | 19700791 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RLA2_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RLA2_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RLA2_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteomics of vasopressin-sensitive renal cells:regulation of aquaporin-2 phosphorylation at two sites."; Hoffert J.D., Pisitkun T., Wang G., Shen R.-F., Knepper M.A.; Proc. Natl. Acad. Sci. U.S.A. 103:7159-7164(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-102 AND SER-105, ANDMASS SPECTROMETRY. | |
| "Phosphoproteomic analysis of rat liver by high capacity IMAC and LC-MS/MS."; Moser K., White F.M.; J. Proteome Res. 5:98-104(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-102 AND SER-105, ANDMASS SPECTROMETRY. | |