UniProt ID | RLA22_ARATH | |
---|---|---|
UniProt AC | Q9SLF7 | |
Protein Name | 60S acidic ribosomal protein P2-2 | |
Gene Name | RPP2B | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 115 | |
Subcellular Localization | ||
Protein Description | Plays an important role in the elongation step of protein synthesis.. | |
Protein Sequence | MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGKDLAELIAAGREKLASVPSGGGGGVAVASATSGGGGGGGASAAESKKEEKKEEKEESDDDMGFSLFE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Phosphorylation | AVLSGKASPTSADIK HHHCCCCCCCHHHHH | 32.00 | 19880383 | |
19 | Phosphorylation | LSGKASPTSADIKTI HCCCCCCCHHHHHHH | 33.77 | 25561503 | |
20 | Phosphorylation | SGKASPTSADIKTIL CCCCCCCHHHHHHHH | 27.59 | 25368622 | |
25 | Phosphorylation | PTSADIKTILGSVGA CCHHHHHHHHHCCCC | 23.05 | 25368622 | |
29 | Phosphorylation | DIKTILGSVGAETED HHHHHHHCCCCCCCH | 17.58 | 25368622 | |
34 | Phosphorylation | LGSVGAETEDSQIEL HHCCCCCCCHHHHHH | 44.55 | 25368622 | |
37 | Phosphorylation | VGAETEDSQIELLLK CCCCCCHHHHHHHHH | 27.16 | 25368622 | |
64 | Phosphorylation | AGREKLASVPSGGGG HCHHHHCCCCCCCCC | 45.02 | 23776212 | |
67 | Phosphorylation | EKLASVPSGGGGGVA HHHCCCCCCCCCCEE | 48.16 | 23776212 | |
77 | Phosphorylation | GGGVAVASATSGGGG CCCEEEEECCCCCCC | 26.02 | 23776212 | |
79 | Phosphorylation | GVAVASATSGGGGGG CEEEEECCCCCCCCC | 25.96 | 23776212 | |
80 | Phosphorylation | VAVASATSGGGGGGG EEEEECCCCCCCCCC | 34.85 | 23776212 | |
89 | Phosphorylation | GGGGGGASAAESKKE CCCCCCCHHHHHHHH | 31.14 | 23776212 | |
93 | Phosphorylation | GGASAAESKKEEKKE CCCHHHHHHHHHHHH | 44.28 | 23776212 | |
105 | Phosphorylation | KKEEKEESDDDMGFS HHHHHHHCCCCCCCC | 47.64 | 30291188 | |
112 | Phosphorylation | SDDDMGFSLFE---- CCCCCCCCCCC---- | 26.81 | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RLA22_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RLA22_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RLA22_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RLA22_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...