| UniProt ID | RLA22_ARATH | |
|---|---|---|
| UniProt AC | Q9SLF7 | |
| Protein Name | 60S acidic ribosomal protein P2-2 | |
| Gene Name | RPP2B | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 115 | |
| Subcellular Localization | ||
| Protein Description | Plays an important role in the elongation step of protein synthesis.. | |
| Protein Sequence | MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGKDLAELIAAGREKLASVPSGGGGGVAVASATSGGGGGGGASAAESKKEEKKEEKEESDDDMGFSLFE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | AVLSGKASPTSADIK HHHCCCCCCCHHHHH | 32.00 | 19880383 | |
| 19 | Phosphorylation | LSGKASPTSADIKTI HCCCCCCCHHHHHHH | 33.77 | 25561503 | |
| 20 | Phosphorylation | SGKASPTSADIKTIL CCCCCCCHHHHHHHH | 27.59 | 25368622 | |
| 25 | Phosphorylation | PTSADIKTILGSVGA CCHHHHHHHHHCCCC | 23.05 | 25368622 | |
| 29 | Phosphorylation | DIKTILGSVGAETED HHHHHHHCCCCCCCH | 17.58 | 25368622 | |
| 34 | Phosphorylation | LGSVGAETEDSQIEL HHCCCCCCCHHHHHH | 44.55 | 25368622 | |
| 37 | Phosphorylation | VGAETEDSQIELLLK CCCCCCHHHHHHHHH | 27.16 | 25368622 | |
| 64 | Phosphorylation | AGREKLASVPSGGGG HCHHHHCCCCCCCCC | 45.02 | 23776212 | |
| 67 | Phosphorylation | EKLASVPSGGGGGVA HHHCCCCCCCCCCEE | 48.16 | 23776212 | |
| 77 | Phosphorylation | GGGVAVASATSGGGG CCCEEEEECCCCCCC | 26.02 | 23776212 | |
| 79 | Phosphorylation | GVAVASATSGGGGGG CEEEEECCCCCCCCC | 25.96 | 23776212 | |
| 80 | Phosphorylation | VAVASATSGGGGGGG EEEEECCCCCCCCCC | 34.85 | 23776212 | |
| 89 | Phosphorylation | GGGGGGASAAESKKE CCCCCCCHHHHHHHH | 31.14 | 23776212 | |
| 93 | Phosphorylation | GGASAAESKKEEKKE CCCHHHHHHHHHHHH | 44.28 | 23776212 | |
| 105 | Phosphorylation | KKEEKEESDDDMGFS HHHHHHHCCCCCCCC | 47.64 | 30291188 | |
| 112 | Phosphorylation | SDDDMGFSLFE---- CCCCCCCCCCC---- | 26.81 | 23776212 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RLA22_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RLA22_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RLA22_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RLA22_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
