UniProt ID | RLA1_RAT | |
---|---|---|
UniProt AC | P19944 | |
Protein Name | 60S acidic ribosomal protein P1 | |
Gene Name | Rplp1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 114 | |
Subcellular Localization | ||
Protein Description | Plays an important role in the elongation step of protein synthesis.. | |
Protein Sequence | MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSAAAAPAEEKKVEAKKEESEESEDDMGFGLFD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MASVSELAC ------CCCHHHHHH | 20.74 | - | |
101 | Phosphorylation | VEAKKEESEESEDDM HHHHHHHCCCCCCCC | 47.99 | 23712012 | |
104 | Phosphorylation | KKEESEESEDDMGFG HHHHCCCCCCCCCCC | 42.12 | 23712012 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RLA1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RLA1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RLA1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RLA1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...