dbPTM

RLA13_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RLA13_ARATH
UniProt AC	Q8LEQ0
Protein Name	60S acidic ribosomal protein P1-3
Gene Name	RPP1C
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	113
Subcellular Localization
Protein Description	Plays an important role in the elongation step of protein synthesis..
Protein Sequence	MSTVGELACSYAVMILEDEGIAITADKIATLVKAAGVTIESYWPMLFAKMAEKRNVTDLIMNVGAGGGGGAPVAAAAPAAGGGAAAAAPAAEEKKKDEPAEESDGDLGFGLFD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSTVGELAC ------CCHHHHHHH	31.62	25368622
3	Phosphorylation	-----MSTVGELACS -----CCHHHHHHHC	31.09	25368622
10	Phosphorylation	TVGELACSYAVMILE HHHHHHHCHHEEEEE	15.54	25368622
11	Phosphorylation	VGELACSYAVMILED HHHHHHCHHEEEEEC	11.78	25368622
103	Phosphorylation	KDEPAEESDGDLGFG CCCCCHHCCCCCCCC	38.10	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RLA13_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RLA13_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RLA13_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RLA13_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RLA13_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteomic analysis of nuclei-enriched fractions fromArabidopsis thaliana."; Jones A.M.E., MacLean D., Studholme D.J., Serna-Sanz A.,Andreasson E., Rathjen J.P., Peck S.C.; J. Proteomics 72:439-451(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-103, AND MASSSPECTROMETRY.	19245862 [Abstract]