UniProt ID | RL9_RAT | |
---|---|---|
UniProt AC | P17077 | |
Protein Name | 60S ribosomal protein L9 | |
Gene Name | Rpl9 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 192 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQPDE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MKTILSNQT ------CCEECCCCC | 44.25 | 22902405 | |
3 | Phosphorylation | -----MKTILSNQTV -----CCEECCCCCC | 26.33 | 23984901 | |
6 | Phosphorylation | --MKTILSNQTVDIP --CCEECCCCCCCCC | 24.04 | 23984901 | |
9 | Phosphorylation | KTILSNQTVDIPENV CEECCCCCCCCCCCE | 25.13 | 23984901 | |
21 | Acetylation | ENVDITLKGRTVIVK CCEEEEECCCEEEEE | 37.38 | 72591715 | |
21 | Ubiquitination | ENVDITLKGRTVIVK CCEEEEECCCEEEEE | 37.38 | - | |
28 | Acetylation | KGRTVIVKGPRGTLR CCCEEEEECCCCCCC | 52.66 | 13577397 | |
33 | Phosphorylation | IVKGPRGTLRRDFNH EEECCCCCCCCCCCC | 20.55 | 23984901 | |
69 | Phosphorylation | GNRKELATVRTICSH CCHHHHHHHHHHHHH | 24.12 | 23984901 | |
72 | Phosphorylation | KELATVRTICSHVQN HHHHHHHHHHHHHHH | 23.23 | 23984901 | |
75 | Phosphorylation | ATVRTICSHVQNMIK HHHHHHHHHHHHHHH | 23.89 | 23984901 | |
121 | Acetylation | IRNFLGEKYIRRVRM EEHHCCHHHHHHHHH | 44.15 | 22635577 | |
130 | Phosphorylation | IRRVRMRTGVACSVS HHHHHHHHCCCCCCC | 27.02 | 28432305 | |
135 | Phosphorylation | MRTGVACSVSQAQKD HHHCCCCCCCHHHCC | 18.31 | 30181290 | |
174 | Acetylation | VKNKDIRKFLDGIYV CCCHHHHHHHCCEEE | 51.08 | 22902405 | |
180 | Phosphorylation | RKFLDGIYVSEKGTV HHHHCCEEECCCCCC | 11.94 | 23984901 | |
182 | Phosphorylation | FLDGIYVSEKGTVQQ HHCCEEECCCCCCCC | 19.33 | 23984901 | |
186 | Phosphorylation | IYVSEKGTVQQPDE- EEECCCCCCCCCCC- | 26.64 | 23984901 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL9_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL9_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL9_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL9_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...