UniProt ID | RL9_MOUSE | |
---|---|---|
UniProt AC | P51410 | |
Protein Name | 60S ribosomal protein L9 | |
Gene Name | Rpl9 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 192 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKTILSNQTVDIPENVEITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Ubiquitination | ------MKTILSNQT ------CCEEECCCE | 44.25 | 22790023 | |
21 | Ubiquitination | ENVEITLKGRTVIVK CCEEEEECCCEEEEE | 37.38 | 22790023 | |
28 | Acetylation | KGRTVIVKGPRGTLR CCCEEEEECCCCCCC | 52.66 | 7622439 | |
28 | Ubiquitination | KGRTVIVKGPRGTLR CCCEEEEECCCCCCC | 52.66 | - | |
28 | Malonylation | KGRTVIVKGPRGTLR CCCEEEEECCCCCCC | 52.66 | 26320211 | |
33 | Phosphorylation | IVKGPRGTLRRDFNH EEECCCCCCCCCCCC | 20.55 | 23140645 | |
59 | Succinylation | KKRLRVDKWWGNRKE CCCEEECCCCCCHHH | 41.82 | 23806337 | |
59 | Acetylation | KKRLRVDKWWGNRKE CCCEEECCCCCCHHH | 41.82 | 23806337 | |
74 | S-palmitoylation | LATVRTICSHVQNMI HHHHHHHHHHHHHHH | 1.97 | 26165157 | |
74 | S-nitrosylation | LATVRTICSHVQNMI HHHHHHHHHHHHHHH | 1.97 | 21278135 | |
74 | Glutathionylation | LATVRTICSHVQNMI HHHHHHHHHHHHHHH | 1.97 | 24333276 | |
74 | S-nitrosocysteine | LATVRTICSHVQNMI HHHHHHHHHHHHHHH | 1.97 | - | |
82 | Acetylation | SHVQNMIKGVTLGFR HHHHHHHHCCCEECE | 36.24 | 22826441 | |
85 | Phosphorylation | QNMIKGVTLGFRYKM HHHHHCCCEECEEEE | 29.81 | 22006019 | |
121 | Acetylation | IRNFLGEKYIRRVRM EEHHCCHHHHHHHHH | 44.15 | 23864654 | |
121 | Ubiquitination | IRNFLGEKYIRRVRM EEHHCCHHHHHHHHH | 44.15 | - | |
130 | Phosphorylation | IRRVRMRTGVACSVS HHHHHHHHCCCCCCC | 27.02 | 25521595 | |
134 | S-nitrosocysteine | RMRTGVACSVSQAQK HHHHCCCCCCCHHHC | 3.71 | - | |
134 | Glutathionylation | RMRTGVACSVSQAQK HHHHCCCCCCCHHHC | 3.71 | 24333276 | |
134 | S-nitrosylation | RMRTGVACSVSQAQK HHHHCCCCCCCHHHC | 3.71 | 21278135 | |
134 | S-palmitoylation | RMRTGVACSVSQAQK HHHHCCCCCCCHHHC | 3.71 | 28526873 | |
170 | Ubiquitination | QATTVKNKDIRKFLD HCHHCCCHHHHHHHC | 49.14 | - | |
174 | Ubiquitination | VKNKDIRKFLDGIYV CCCHHHHHHHCEEEE | 51.08 | 22790023 | |
174 | Acetylation | VKNKDIRKFLDGIYV CCCHHHHHHHCEEEE | 51.08 | 23806337 | |
180 | Phosphorylation | RKFLDGIYVSEKGTV HHHHCEEEECCCCCC | 11.94 | 29514104 | |
182 | Phosphorylation | FLDGIYVSEKGTVQQ HHCEEEECCCCCCEE | 19.33 | 29514104 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL9_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL9_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL9_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL9_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...