RL92_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL92_ARATH
• UniProt AC: Q9SZX9
• Protein Name: 60S ribosomal protein L9-2
• Gene Name: RPL9D
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 194
• Protein Sequence: MKTILSSETMDIPDGVAIKVNAKVIEVEGPRGKLTRDFKHLNLDFQLIKDQVTGKRQLKIDSWFGSRKTSASIRTALSHVDNLIAGVTQGFLYRMRFVYAHFPINASIDGNNKSIEIRNFLGEKKVRKVEMLDGVKIVRSEKVKDEIILEGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGKIAVEE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MKTILSSETMDIP --CCEECCCCCCCCC	23.44	23111157
75	Phosphorylation	KTSASIRTALSHVDN CCCHHHHHHHHHHHH	30.22	22092075
158	Phosphorylation	GNDIELVSRSCALIN CCCCHHHHHHHHHHC	30.97	23820729

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL92_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL92_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL92_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RL92_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.