dbPTM

RL8_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RL8_SCHPO
UniProt AC	O13672
Protein Name	60S ribosomal protein L8
Gene Name	rpl8
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	259
Subcellular Localization
Protein Description
Protein Sequence	MAPKSKKVAPSPFAQPKAAKTTKNPLFVSRPRSFGIGQDIQPKRDLSRFVKWPEYIRLQRRRKILNLRLKVPPAIAQFQKTLDKNTATQVFKLLNKYRPETAAEKKQRLVAEAEAVANGKSAQDVSKKPYNVKYGLNHVVALIEAKKAKLVLIASDVDPIELVVFLPALCKKMGVPYAIVKNKARLGTVIHQKTAAVLAVTEVREEDKNELASIVSAVDANFSAKYDESRRKWGGGIMGGKTQALLAKRAKAAAATVRL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MAPKSKKVAPSP ---CCCCCCCCCCCC	36.33	25720772
11	Phosphorylation	KSKKVAPSPFAQPKA CCCCCCCCCCCCCCC	23.94	28889911
29	Phosphorylation	TKNPLFVSRPRSFGI CCCCCEECCCCCCCC	29.27	25720772
33	Phosphorylation	LFVSRPRSFGIGQDI CEECCCCCCCCCCCC	30.43	28889911
121	Phosphorylation	EAVANGKSAQDVSKK HHHHCCCCHHHHCCC	32.34	25720772
126	Phosphorylation	GKSAQDVSKKPYNVK CCCHHHHCCCCCCCC	43.16	25720772
134	Phosphorylation	KKPYNVKYGLNHVVA CCCCCCCCCHHHHHH	23.67	25720772
177	Phosphorylation	CKKMGVPYAIVKNKA HHHHCCCEEEECCCC	13.42	25720772
194	Phosphorylation	GTVIHQKTAAVLAVT CCHHHHHCHHEEEEE	17.18	25720772
213	Phosphorylation	EDKNELASIVSAVDA HHHHHHHHHHHHHHH	35.83	24763107
216	Phosphorylation	NELASIVSAVDANFS HHHHHHHHHHHHCCC	22.39	29996109
223	Phosphorylation	SAVDANFSAKYDESR HHHHHCCCCCCCHHH	24.53	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RL8_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RL8_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RL8_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RL8_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RL8_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-11 AND SER-33, AND MASSSPECTROMETRY.	18257517 [Abstract]