dbPTM

RL7C_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RL7C_SCHPO
UniProt AC	O60143
Protein Name	60S ribosomal protein L7-C
Gene Name	rpl701
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	251
Subcellular Localization
Protein Description
Protein Sequence	MAVASSTVPSKEQIFAPESLLKKKKTQEQSREQRVAAAAEKKAAQQKKRELIAKRAESYDAEYRKAEREQIELGRKARAEGNYYVPDETKLVFVIRIRGINNIPPKARKIMQLLRLIQINNGVFVKFNKATKEMLQVVEPYVTYGIPNLKTVRELLYKRGFGKVNKQRIALSDNAIIEAALGKYSILSIEDLIHEIYTVGPNFKQAANFIWPFQLSSPLGGWRDRKFKHFIEGGDAGKRDEHINSLVRKML

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
58	Phosphorylation	LIAKRAESYDAEYRK HHHHHHHHHCHHHHH	27.59	28889911
59	Phosphorylation	IAKRAESYDAEYRKA HHHHHHHHCHHHHHH	15.63	25720772
83	Phosphorylation	KARAEGNYYVPDETK HHHHCCCEECCCCCE	19.39	25720772
84	Phosphorylation	ARAEGNYYVPDETKL HHHCCCEECCCCCEE	14.98	25720772
172	Phosphorylation	NKQRIALSDNAIIEA CHHHEECCCCHHHHH	21.57	25720772
245	Phosphorylation	KRDEHINSLVRKML- CHHHHHHHHHHHHC-	27.86	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RL7C_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RL7C_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RL7C_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RL7C_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RL7C_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-58 AND SER-245, AND MASSSPECTROMETRY.	18257517 [Abstract]