RL7A1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL7A1_ARATH
• UniProt AC: P49692
• Protein Name: 60S ribosomal protein L7a-1
• Gene Name: RPL7AA
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 257
• Protein Sequence: MAPKKGVKVAAKKKTAEKVSNPLFERRPKQFGIGGALPPKKDLSRYIKWPKSIRLQRQKRILKQRLKVPPALNQFTKTLDKNLATSLFKVLLKYRPEDKAAKKERLVKKAQAEAEGKPSESKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEVPYCIVKGKSRLGAVVHQKTASCLCLTTVKNEDKLEFSKILEAIKANFNDKYEEYRKKWGGGIMGSKSQAKTKAKERVIAKEAAQRMN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	Phosphorylation	KKTAEKVSNPLFERR CCCHHHCCCHHHHCC	43.74	29654922
85	Phosphorylation	TLDKNLATSLFKVLL HHCHHHHHHHHHHHH	29.18	25561503
86	Phosphorylation	LDKNLATSLFKVLLK HCHHHHHHHHHHHHH	26.63	25561503
121	Phosphorylation	AEGKPSESKKPIVVK HCCCCCCCCCCEEEE	50.76	25561503
172	Phosphorylation	CRKMEVPYCIVKGKS HHHCCCCEEEEECCC	10.45	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL7A1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL7A1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL7A1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RL7A1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.