dbPTM

RL6_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RL6_CAEEL
UniProt AC	P47991
Protein Name	60S ribosomal protein L6
Gene Name	rpl-6
Organism	Caenorhabditis elegans.
Sequence Length	217
Subcellular Localization	Cytoplasm, cytosol . Cytoplasm . Rough endoplasmic reticulum . Detected on cytosolic polysomes (By similarity). Detected in ribosomes that are associated with the rough endoplasmic reticulum (By similarity).
Protein Description	Component of the large ribosomal subunit..
Protein Sequence	MVGKRNLPVISRNFDLSPGVLRFSASRLRLKKGEKKPKFTKDTSAKLPKLQRNGTKFALGHSKTVTLRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATSLKVNVSGVKIPEHINDEYFKRKSTAQKTGKNIFASGKTEYTVSEQRKKDIKTVDAPILAAIKKHPEHKFLFGYLGTRFSLGKNQYPHKMQF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	KRNLPVISRNFDLSP CCCCCCEECCCCCCH	22.77	19530675
17	Phosphorylation	ISRNFDLSPGVLRFS EECCCCCCHHHHEEE	22.81	28854356
24	Phosphorylation	SPGVLRFSASRLRLK CHHHHEEEHHHHHCC	20.92	28854356
26	Phosphorylation	GVLRFSASRLRLKKG HHHEEEHHHHHCCCC	30.56	28854356
55	Phosphorylation	PKLQRNGTKFALGHS CHHHCCCCEEECCCC	26.91	19530675
70	Phosphorylation	KTVTLRKTLTPGTVL CEEEEECCCCCCEEE	29.45	28854356
125	Phosphorylation	GQAFVIATSLKVNVS CCEEEEEEEEEEECC	24.38	28854356
126	Phosphorylation	QAFVIATSLKVNVSG CEEEEEEEEEEECCC	19.71	28854356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RL6_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RL6_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RL6_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RL6_CAEEL

Related Literatures of Post-Translational Modification