RL63_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL63_ARATH
• UniProt AC: Q9C9C5
• Protein Name: 60S ribosomal protein L6-3
• Gene Name: RPL6C
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 233
• Protein Sequence: MPAKQRTPKVNRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPVEKPPKFYPAEDVKKPLPNRRTAKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLASGLLLVTGPFKINGVPLRRVNQAYVIGTSTKVDISGVTLDKFDDKYFGKVAEKKKKKTEGEFFEAEKEEKKEIPQVKKDDQKAVDAALIKAIEAVPELKTYLGARFSLKQGMKPHELVF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
138	Phosphorylation	LRRVNQAYVIGTSTK CCEECEEEEEECCEE	5.26	19880383
142	Phosphorylation	NQAYVIGTSTKVDIS CEEEEEECCEEEEEC	23.31	23820729
143	Phosphorylation	QAYVIGTSTKVDISG EEEEEECCEEEEECC	22.48	23820729
144	Phosphorylation	AYVIGTSTKVDISGV EEEEECCEEEEECCE	34.62	23820729

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL63_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL63_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL63_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RL63_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.