UniProt ID | RL63_ARATH | |
---|---|---|
UniProt AC | Q9C9C5 | |
Protein Name | 60S ribosomal protein L6-3 | |
Gene Name | RPL6C | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 233 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPAKQRTPKVNRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPVEKPPKFYPAEDVKKPLPNRRTAKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLASGLLLVTGPFKINGVPLRRVNQAYVIGTSTKVDISGVTLDKFDDKYFGKVAEKKKKKTEGEFFEAEKEEKKEIPQVKKDDQKAVDAALIKAIEAVPELKTYLGARFSLKQGMKPHELVF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
138 | Phosphorylation | LRRVNQAYVIGTSTK CCEECEEEEEECCEE | 5.26 | 19880383 | |
142 | Phosphorylation | NQAYVIGTSTKVDIS CEEEEEECCEEEEEC | 23.31 | 23820729 | |
143 | Phosphorylation | QAYVIGTSTKVDISG EEEEEECCEEEEECC | 22.48 | 23820729 | |
144 | Phosphorylation | AYVIGTSTKVDISGV EEEEECCEEEEECCE | 34.62 | 23820729 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL63_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL63_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL63_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL63_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...