RL61_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL61_ARATH
• UniProt AC: Q9FZ76
• Protein Name: 60S ribosomal protein L6-1
• Gene Name: RPL6A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 233
• Protein Sequence: MPAAKRTPKVNRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAQPKVDAPVEKPAKFYPAEDVKKPLVNRRKPKPTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPLRRVNQAYVIGTSTKIDISGVNTEKFDDKYFGKVAEKKKKKTEGEFFEAEKEEKKEIPQEKKEDQKTVDAALIKSIEAVPELKVYLGARFSLSQGMKPHELVF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
138	Phosphorylation	LRRVNQAYVIGTSTK CCEECEEEEEECCEE	5.26	23820729
142	Phosphorylation	NQAYVIGTSTKIDIS CEEEEEECCEEEECC	23.31	23820729
143	Phosphorylation	QAYVIGTSTKIDISG EEEEEECCEEEECCC	23.61	23820729
144	Phosphorylation	AYVIGTSTKIDISGV EEEEECCEEEECCCC	31.68	23820729
205	Phosphorylation	VDAALIKSIEAVPEL HCHHHHHHHHHCCHH	20.76	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL61_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL61_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL61_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RL61_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.